KEGG   Halorhodospira halophila: Hhal_0155Help
Entry
Hhal_0155         CDS       T00462                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
hha  Halorhodospira halophila
Pathway
hha03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hha00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Hhal_0155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hha02044]
    Hhal_0155
Secretion system [BR:hha02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Hhal_0155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF2345
Motif
Other DBs
NCBI-ProteinID: ABM60949
UniProt: A1WTD7
Position
complement(180465..182525)
Genome map
AA seq 686 aa AA seqDB search
MKGSAKEGGGAHALFRVRLPGLDPDVLRVEQIVGHQALDDGDRLQVRVCGPVGDRVREWP
GQLVALTLGWGVAPRTLHGVISEVALCGGEMSSRAATLTVCSLLHPLAGSYRRRVYRRCS
ALHMAREVLQGALPDGVSVTVGVERSLPERPLVVQGAADDLAFLRRVLAREGCFPVVRDA
GGRPEVRIVDHLAQAELDAAALTWRPGGGPTPTTRATVSEVSRRWTLQPGQVRVGGFDPA
LPDRGRPATAGTDAAEDSPMELGLHGVTAGGESAHAEWAEAVHEASAAQRCRIEAVVATP
LLPGMRVVISGHPEASLNGAYWVYRAEHEGDQAAAIHGGGGADRVDYRGRVELLPLDPGY
RPAPVPAPAIPGVAVAWVAGGDPERAEVDEAGAYRIRLFDEAEAADGVEAAPPGPPVWAV
QPSAGAQHGLHLPLLPGTRVAVAGLHGDLEQPVILGALSSQDQPGPVTDRNPHQHLLRTA
AGQRLLLDDRPGAEGAELAVGEAARLSLEGHEEAPGATLEAPNGYLELASGGEQRVRSGG
DQRLDVAGAYRVEVEGSYHLETEDGALHWFAGDTLHLETGAGDLLHEAPDGEVALKAGRQ
VSLDAGSGLRLIARQGAGDWQVESGALRLEAAGDVALVSTGGGCLQLGDGFGLRIEDSGA
VYVEGRHIELSAEQLVIAADRIEEGR
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggagtgccaaggaaggcggtggcgcgcacgcgctgtttcgggtgcgtctaccg
ggattggacccggacgtgctgcgggtcgagcagattgtcggtcatcaggcactggatgac
ggtgaccgtctgcaggtccgggtgtgtggcccggtcggggatcgggtccgggagtggccc
gggcagctggtcgcgttgaccctgggttggggggtggcgccgcgaacactgcacggggtg
atcagcgaggtggccctctgcgggggggagatgtcctcgcgggcggcgaccctgaccgtg
tgctcgctgctccatcccctggccggatcataccggcggcgggtctatcggcgttgttcg
gccttgcacatggcccgcgaagtcctccagggcgcgctgcccgacggggtgtcggtcacc
gtgggggtggagcggtccctgccggagcggccactggtcgtccagggcgctgcggatgac
ctggccttcctgcgccgggtgttggcccgggaggggtgtttcccggtggtgcgggatgcc
ggtgggcggccagaggtccgcatcgtcgatcatctggcgcaggccgaactcgacgcggcg
gcgctgacctggcgcccgggcggtgggccgaccccgaccacccgggcgaccgtctccgag
gtctcccgccgctggacgctgcagccggggcaggtgcgggtcggcggtttcgatccggcg
ttgcccgaccgcgggcgtcccgccacggcaggcaccgacgccgcggaggacagtccgatg
gagttggggctccacggggtcacggcgggtggtgagtcggcccatgcagagtgggccgag
gccgtgcacgaggcctccgcggcccagcgctgccgtatcgaggcggtcgtggcgacgccg
ttgctgcccgggatgcgggtggtcatctccgggcatccggaggcttcgctcaatggcgct
tactgggtctaccgcgccgagcacgagggggaccaggccgcggcgattcacggcggtggt
ggtgcggatcgggtggactaccgggggcgggtggagctcctgccgctcgaccccggttac
cggccggccccggtgcctgcacccgcgatcccgggggtcgccgtggcatgggtcgctggc
ggggatccggagcgcgccgaggtcgacgaggccggggcgtaccggattcgcctgttcgac
gaggccgaggcggccgatggggtcgaggcagccccaccggggccgccggtctgggccgtc
cagccgagcgccggtgcgcagcacggcctgcacttgcccctgctgcccgggacgcgcgtg
gcggtggcggggttgcacggcgacctggaacagccagtgatcctgggggccctgagcagt
caggatcagcccggtcccgtgacggaccgcaatccccaccagcacctgctgcggaccgcg
gccgggcagcgcctgctgctggacgaccggcccggggccgagggggcggagctggccgtg
ggcgaggccgcgcgactgagtctggaggggcacgaggaggcccccggggcaacgctggag
gcccccaacggttatctcgagctggccagcggcggagaacagcgcgtgcgcagcggtggc
gatcagcggctcgatgtggccggggcctatcgggtggaggtcgaagggagctaccacctg
gagacggaggacggcgcgttgcactggtttgccggcgacaccctgcatctggagaccggc
gcgggggatctgctgcacgaggcgccagacggggaagtggccctgaaggcggggcgtcag
gtgtcgctggatgcgggatcaggattgcggttgatcgcccgacagggtgcgggcgactgg
caggttgaatcgggcgcgctgcgcctggaggcggccggcgacgtcgccctggtcagcacc
gggggcggctgtctgcagctcggcgacggcttcgggctgcgcatcgaggacagtggtgcg
gtctatgtcgaggggcggcacattgagctcagcgccgagcaattggtgatcgctgccgac
cgcatcgaggaggggcggtga

DBGET integrated database retrieval system