KEGG   Halorhodospira halophila: Hhal_0158Help
Entry
Hhal_0158         CDS       T00462                                 

Definition
(GenBank) protein of unknown function DUF1316
  KO
K11905  type VI secretion system protein
Organism
hha  Halorhodospira halophila
Brite
KEGG Orthology (KO) [BR:hha00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hha02044]
    Hhal_0158
Secretion system [BR:hha02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Hhal_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: ABM60952
UniProt: A1WTE0
Position
complement(185144..185581)
Genome map
AA seq 145 aa AA seqDB search
MTVGLFDRLEGGTGRPPPHTGTMPGSESRASVVRHILRLLAARRGRPAHLAGYGLPDLSS
YYHDLDGAAACLATAAQELIPRYEPRVVSLAVHAQPASVETGYVLWLALRAQLHRGKHLT
LELAVDGNAGVHLLSGGGDGSASGV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtagggcttttcgatcgcctggaagggggcactggtcgcccgccgccgcacacc
gggacgatgcctgggagcgagagtcgggcgagcgtggttcggcacatcctccggttgctg
gcagcgcgccgcggacgcccggcccacctggccggctacggactgccggacctctcgtcc
tactaccacgatctggacggcgccgctgcgtgcttggcgacggccgctcaggagttgatc
ccccgttacgagccccgggtcgtcagcctggccgtgcacgcgcagcccgcttcggtggag
acgggctacgtgctctggctggcgttgcgcgcgcagctgcaccggggcaaacacctgacg
ctggagctggcggtggacggaaacgccggcgtacacctgctcagcggaggtggggatgga
tctgcgtcgggcgtttga

DBGET integrated database retrieval system