KEGG   Halorhodospira halophila: Hhal_0162
Entry
Hhal_0162         CDS       T00462                                 

Definition
(GenBank) ImpA domain protein
  KO
K11910  type VI secretion system protein VasJ
Organism
hha  Halorhodospira halophila
Brite
KEGG Orthology (KO) [BR:hha00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hha02044]
    Hhal_0162
Secretion system [BR:hha02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Hhal_0162
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: ABM60956
UniProt: A1WTE4
Position
complement(188287..189783)
AA seq 498 aa
MTEECHPDATDHPLGLPGRVLAALDGDADVGADPRHGERFARLREAVQRLGGADFAQVAE
DAAVLLEQEAKDLRVLGYLCLAELQERGLEGFRAALAALHGALAAFGERIHPQRDGGRRA
AIEWLSERRMLALLDRAAGRDDPEQLRALEAELDRLGAELERLWSDPPGLRPLRNWVQER
QTAVAVATERTAPTQPGAREDDRSPGPPRSGQELGRRLREALDFLRSEGEWLAMTALARA
WRWGRLGPLSADDGRLRIEPPRQVALTAIRRHVDEGAWEAAYLAAESAFLEPGGHLQLEI
QAVAERSATAMGRDDIAAYIRAAAAELLQRHPALPDLRFSDGSPLVPPGQVAWVADRVGT
GDESPWREEGETPVQLGEALALMRSEGLAAALRQIDATPQRSGRERCAQELVRARLCLDA
GYPELARARLELLAAEIERRGLDEWDPESTLAVWRELALALQASERDGQLDREQVARRLL
ALRHRVARADLEAAIAFP
NT seq 1497 nt   +upstreamnt  +downstreamnt
gtgaccgaggagtgccatcccgatgcgacggaccacccgctggggctgccggggcgtgtc
cttgccgccctggacggggatgcggacgtaggcgccgatccacgccacggtgagcggttc
gctcgcctgcgcgaggcggtccagcggctgggcggggcggatttcgcccaggtcgccgag
gacgcggcggtcctgctggagcaggaggccaaggatctccgcgtgcttggttacctgtgc
ctggccgagctccaggagcgtggactcgaggggtttcgcgcggcgctggcggcactgcac
ggcgctctggccgcgttcggcgagcggatccatccgcagcgggacggtggccggcgggcg
gccatcgagtggctgtcggagaggcgcatgctggccctgctcgatcgggcggccggccgc
gatgatcccgagcagctgcgcgccctggaagcggagctcgaccggctgggcgcggagctg
gagcggttgtggtcggacccgccggggctgcggccgctgcgcaactgggtgcaggaacgg
cagaccgccgttgccgtggccaccgagcggactgcgcctacgcagcccggcgcgcgggag
gatgaccgttcgccgggtccgccgcgaagtggccaggagctgggacggcggctgcgcgag
gcgctggatttcctgcgcagcgagggcgagtggctggcgatgaccgcgctggctcgcgcc
tggcgctgggggcggcttggaccgctgagcgccgacgatggtcggctgcgcatcgagcca
ccgcgccaggtggcgctgaccgcgatacgaaggcacgtcgatgaaggcgcctgggaagcg
gcctacctggccgccgaatcggccttcctggagccgggcgggcacctccagctggagatc
caggccgtcgctgaacggtcggcgacggcgatggggcgagacgatatcgctgcgtacatc
cgtgcggcagcggcggagttgctacagcgccacccggcgttgccggatctgcgcttcagt
gatggcagcccattggtccccccgggacaggtcgcctgggtggccgatcgcgtgggaacg
ggtgacgaatcgccatggcgggaggagggtgagaccccggtgcaactcggtgaggcgctg
gcgttgatgcgcagcgaaggactggcagccgcgctgcggcaaatcgatgccacgccgcag
cgcagcggtcgcgagcgctgcgcccaggagctggttcgggcgcgcctctgcctggatgcc
ggctatcccgagctggcccgggcgcgccttgagctgctggcggcggagatcgaacgccgg
gggttggacgagtgggatccggaatcaacgctggcggtttggcgggaactggcgctggca
ctgcaagccagcgagcgcgacggtcagctcgatcgcgagcaggtggctcggcgcctgctc
gcactgcgccaccgggtggcgcgtgccgatctggaggcggcgatcgccttcccctga

DBGET integrated database retrieval system