KEGG   Halorhodospira halophila: Hhal_0254Help
Entry
Hhal_0254         CDS       T00462                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
hha  Halorhodospira halophila
Brite
KEGG Orthology (KO) [BR:hha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hha03016]
    Hhal_0254
Enzymes [BR:hha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     Hhal_0254
Transfer RNA biogenesis [BR:hha03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Hhal_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ABM61048
UniProt: A1WTN6
Position
complement(290629..291378)
Genome map
AA seq 249 aa AA seqDB search
METADQDDRSLAILYRDERLIAVYKPAGLLVHRSNIDRDRDVVLQRLRDQLGGHWVYPVH
RLDRATAGVLVFGLDPDAASVLAAAFREQRIGKRYQAVVRGWVEAPGRIDRPLGAGRRGE
GGAPQPAVTDYVPLAWTELPIPVSRYDTARFTRLALHPQTGRQHQLRRHMKAISHPILGD
TTHGDGANNRFFREHFGARRLLLVATELVVPHPADGGAVRLATEPDAELQAIFRRAGLGE
APSPADEAG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtggagaccgcagaccaggacgatcgcagcctcgccatactctaccgggatgagcggctg
atcgccgtctacaagcccgccgggctgctggtccaccgcagcaacatcgaccgcgaccgg
gacgtggtcctgcagcgcctccgcgatcagctcggcgggcactgggtctatccggtccac
cggctcgaccgtgccaccgccggcgtgctggtcttcggcctcgatcccgatgccgcctcg
gtcctggctgccgccttccgcgagcaacgcatcggcaagcgctaccaggccgtggtccgc
ggctgggtggaggcgcccggacgcatcgatcggcccctgggggcggggcgacggggtgag
gggggcgcgccgcagccggcggtgaccgattacgtgccgctggcctggacggagctgccc
attccggtctcgcgctacgacaccgcccgcttcacccggctggcgctgcatccgcagacc
ggccggcagcaccagctgcgccgccacatgaaggcgatcagccacccgatcctcggcgat
accacccacggcgatggcgccaacaaccggttcttccgggaacacttcggtgcccggcgg
ctgctgcttgtggccacggaactggtcgtcccccaccccgcggacgggggcgccgtgcgc
ctggccacggagcccgatgccgagctccaggccatcttccgccgggcgggcctgggagag
gcgccgtcccccgccgacgaggccggctag

DBGET integrated database retrieval system