KEGG   Halorhodospira halophila: Hhal_1460Help
Entry
Hhal_1460         CDS       T00462                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hha  Halorhodospira halophila
Pathway
hha00900  Terpenoid backbone biosynthesis
hha01100  Metabolic pathways
hha01110  Biosynthesis of secondary metabolites
hha01130  Biosynthesis of antibiotics
Module
hha_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:hha00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hhal_1460
Enzymes [BR:hha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Hhal_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh TIR_2
Motif
Other DBs
NCBI-ProteinID: ABM62227
UniProt: A1WX15
Position
complement(1576410..1577582)
Genome map
AA seq 390 aa AA seqDB search
MRLAVLGATGSIGTSTLDVAIRHPERFEVRAVAAGRDWEGLLRICRAHRPSRAALADEQA
AAQLRDRLQAEGLEHIEVSAGEEGVAALAADADVDAVVTAVVGAAGLASSLAACRAGKRI
LLANKETLVVAGALFMETAQRHGAQIVPVDSEHNAVFQGLPTGTDATAGVERIVLTASGG
PFRDRDPDTLAAVTPEEAVAHPNWSMGRKISVDSATMMNKGLEVIEACHLFDLEPQRVDV
VIHRQSLVHALVGYRDGSYLAQVGSPDMRVPISYAMGYPERIASGVDLVDLAAAGRLDFE
AVDERRFPCLRLAYQALRTGDGACAVLNAANEIAVDAFLDGRLRFDRIAPVIEDALAAET
PPPPKDLDSARAIDAQARRVAEEAVRRIAD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcggctggcagtactcggggccacggggtccattggtacgagcaccctggatgtggca
atcaggcaccccgaacgtttcgaggttcgggccgtggctgcagggcgcgattgggaaggg
ttgctgcggatctgccgtgcgcaccgccccagccgagccgcgctggccgatgagcaggcg
gcggcgcagttgcgcgatcggcttcaggccgaaggcctggagcacatcgaggtctccgcg
ggcgaagagggcgtggccgcgctggcggcggacgccgacgtggatgcagtggtcacggcc
gtggtcggggcggcggggctggcctcgtccctggcggcctgccgggccggcaagcggatt
ctcctggccaacaaggagacgctggtcgtcgccggtgccctgttcatggagacggcgcag
cgccatggggcgcagatcgtcccggtggacagtgagcacaacgccgtattccaggggctg
ccgaccggcaccgacgccacggcgggggtggagcgcatcgtgctgacggcatccggtggc
ccgttccgcgatcgggatcccgacaccctggccgccgtgacccccgaggaggccgtagcc
catccgaactggtccatgggccgcaagatctccgtcgattcagccaccatgatgaacaag
ggccttgaggtgatcgaggcctgccatctctttgacctggaacctcagcgcgtcgatgtg
gtcattcatcgacagagcttggtgcatgcgctggtgggctatcgcgacggttcctatttg
gcgcaggtcgggtcgccggacatgcgagtgccgatctcctacgccatggggtatcccgag
cggatcgcctcgggtgtggatctggtggatctggcggccgcagggcgcctcgacttcgaa
gcagtggacgagcgccgcttcccctgcctccgactggcctatcaggccctgcgtaccggc
gacggcgcgtgcgccgtactcaatgcggccaatgagattgcggtggacgccttcctcgac
gggcgtcttcgtttcgaccgcattgcacctgtgatcgaggacgccctggcagcggagacc
cctccgccgccgaaggatctggattcggcccgcgccatcgatgcgcaggcccgccgtgtg
gccgaggaggccgtgcggcgcatcgcggactga

DBGET integrated database retrieval system