KEGG   Halorhodospira halophila: Hhal_1674Help
Entry
Hhal_1674         CDS       T00462                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
hha  Halorhodospira halophila
Pathway
hha00670  One carbon pool by folate
hha01100  Metabolic pathways
hha01120  Microbial metabolism in diverse environments
hha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Hhal_1674
Enzymes [BR:hha01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Hhal_1674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ABM62438
UniProt: A1WXM6
Position
complement(1826335..1827249)
Genome map
AA seq 304 aa AA seqDB search
MESQKKHPRVFSFEFFPPKTDEGAENLKGTRERLERLNPAYFSVTFGAGGSTQDRTFETV
IDIQRNSTADAAPHLSCIDASRDRLKQMILDYKEQGVKYIVALRGDRPSGSGSMGQGELS
YANELVELIREVTGDHFYIEVGAYPEFHPEAPDALTDIENFVRKAKAGADSAITQFFYNA
DCYYRFVEDCEKRGVDIPIVPGIMPLMNFEQQARFAAACKADMPRWLAQRMEAWKDDPQS
RMEYGIDVVTRLCEDLLDNGAPGIHFYALNKAPVVERIWHNLGLSEQTGGEVRKPDEVEV
PAQP
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtcaaaagaaacacccccgcgtcttcagtttcgagttcttcccgcccaagacc
gacgagggcgcggagaacctgaagggcacgcgggagcgcctggagcggctgaacccggct
tacttttcggtgaccttcggcgccggggggtcgacccaggatcgcaccttcgagacggtg
atcgacatccagcgcaacagcaccgccgacgctgcgccgcacctgtcgtgcatcgacgcc
agtcgggatcggctcaagcagatgatcctcgactacaaagagcagggtgtgaagtacatc
gtcgccctgcgcggcgatcggccgtccggctccgggtccatggggcagggcgagctgagt
tacgccaacgagctcgtcgagctgatccgcgaggtcaccggtgaccacttctacatcgag
gtgggcgcctatccggagttccacccggaggccccggacgcactgaccgatatcgagaac
ttcgtccgcaaggccaaggccggcgcggactcggccatcacgcagttcttctacaacgcg
gactgctactaccgctttgtcgaggattgcgagaagcgcggggtggacatcccgatcgtc
cccggcatcatgccgctgatgaacttcgagcagcaggcgcgattcgccgcggcctgcaag
gccgacatgccgcgctggctggcacagcggatggaggcctggaaagatgacccacagtcg
cggatggagtacggcatcgacgtcgtgacgcggctttgcgaggacctgctggacaatggt
gcgcccggcatccacttctacgccttgaacaaggcgccggtggtcgagcgcatctggcac
aaccttgggctgtcggagcagaccggcggcgaggtgcgcaagccggacgaggtcgaggtg
ccggcgcagccgtaa

DBGET integrated database retrieval system