KEGG   Halorhodospira halophila: Hhal_1685Help
Entry
Hhal_1685         CDS       T00462                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hha  Halorhodospira halophila
Pathway
hha00071  Fatty acid degradation
hha00280  Valine, leucine and isoleucine degradation
hha00310  Lysine degradation
hha00380  Tryptophan metabolism
hha00620  Pyruvate metabolism
hha00630  Glyoxylate and dicarboxylate metabolism
hha00640  Propanoate metabolism
hha00650  Butanoate metabolism
hha00900  Terpenoid backbone biosynthesis
hha01100  Metabolic pathways
hha01110  Biosynthesis of secondary metabolites
hha01120  Microbial metabolism in diverse environments
hha01130  Biosynthesis of antibiotics
hha01200  Carbon metabolism
hha01212  Fatty acid metabolism
hha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hhal_1685
   00630 Glyoxylate and dicarboxylate metabolism
    Hhal_1685
   00640 Propanoate metabolism
    Hhal_1685
   00650 Butanoate metabolism
    Hhal_1685
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Hhal_1685
   00072 Synthesis and degradation of ketone bodies
    Hhal_1685
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hhal_1685
   00310 Lysine degradation
    Hhal_1685
   00380 Tryptophan metabolism
    Hhal_1685
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hhal_1685
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hhal_1685
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Hhal_1685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hha04147]
    Hhal_1685
Enzymes [BR:hha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Hhal_1685
Exosome [BR:hha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hhal_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABM62449
UniProt: A1WXN7
Position
1839722..1840906
Genome map
AA seq 394 aa AA seqDB search
MSQRRVVICSPTRTPIGTFGGSLKTVPAPDLGATAIRGTLERSGLDPAAVDTVVMGNVIQ
AGCKMNPARQASINGGVPAETPALTVNRVCGSGAQAIANAFQEVALGFADTAVAGGMENM
DRAPYLLMQGRYGYRLGHQQILDAVLSDGLNDAFSDQHSGWHTEDLAEQYQISRQEQDEW
ALRSQQRFSAAQSTGHFEAEITPVDVPGRKGPTRFEADEHNRGDTTLEGLQKLRPAFRKE
GTITAGNAPGVNTGAAAMVVAEEEAARKHGLTPAARLVAYGVGGVEPGMFGIGPVPAVRQ
CLQRAGWSADEVGRWEINEAFAAIAIAVTRDLGLDPERVNVEGGAVAHGHPIGATGAVLT
TRLIHAMQRDGVDKGVVTMCIGGGQGVALAIERV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagcgccgagtcgtcatctgctcacccacacgcacgcccatcgggacgtttggc
gggtccctcaagaccgtaccggcccccgacctcggtgccaccgccatccgcggcaccctg
gagcgctccggcctcgatccggcagccgtggataccgtggtcatgggcaacgtgatccag
gccggctgcaagatgaacccggcccgccaggcctcgatcaacggcggcgtccccgcggaa
acgccggcactgaccgtcaaccgggtctgcggctctggcgcccaggccatcgccaacgcc
ttccaggaggtggccctcggctttgccgacaccgctgttgccggcggcatggagaacatg
gaccgggcgccgtacttgctcatgcaggggcgctacgggtaccgcctcggccaccagcag
atcctcgacgccgtactcagcgacggcctcaatgacgccttctccgaccagcactccggc
tggcataccgaggatctggccgagcagtatcagatcagccgccaggaacaggacgagtgg
gcactccgttcccagcaacggttcagcgccgcccagtccaccggccacttcgaggcggag
atcactccggtggacgtgcccggccgcaaggggcccacgcgcttcgaggccgatgagcat
aaccgcggcgacaccacgctggaggggctgcagaagctgcgcccggcattccgcaaggag
ggcaccatcaccgccggcaacgcccccggggtcaacacgggtgcagccgccatggtggtc
gccgaggaagaggccgcccgcaagcacgggctcacgccggcagcgcgcctggtcgcctac
ggcgtcggcggtgtcgagccggggatgttcgggatcggccccgtgcccgcggtcaggcag
tgcctccagcgcgccggctggtccgccgacgaggtggggcgctgggagatcaacgaggcg
tttgcagcgatcgccatcgccgtcacccgcgacttgggcctggacccggagcgggtcaac
gtcgaggggggcgctgtcgcccacggccacccgatcggcgcaaccggcgcagtgctcacc
acccggctaatccacgccatgcagcgagacggcgtggacaagggcgtggtcaccatgtgc
atcggcggcggccagggcgtggccctggcgatcgaacgggtctaa

DBGET integrated database retrieval system