KEGG   Halorhodospira halophila: Hhal_2074Help
Entry
Hhal_2074         CDS       T00462                                 

Definition
(GenBank) protein of unknown function DUF548
  KO
K15984  16S rRNA (guanine1516-N2)-methyltransferase [EC:2.1.1.242]
Organism
hha  Halorhodospira halophila
Brite
KEGG Orthology (KO) [BR:hha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hha03009]
    Hhal_2074
Enzymes [BR:hha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.242  16S rRNA (guanine1516-N2)-methyltransferase
     Hhal_2074
Ribosome biogenesis [BR:hha03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    Hhal_2074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAM_MT Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: ABM62838
UniProt: A1WYS6
Position
2279405..2280208
Genome map
AA seq 267 aa AA seqDB search
MHAGLRCDASTDPGLCGVVAVGDHPAAAAAWAEQLGVPVLEHRPQEGSGVILLADEPPAL
QLLGRRAPGPVAIDFTDHQLQRRVAGSTLRRDPLARAVGLHRRPQTAVVDATAGLGHDGW
VLAALGARMTWIERSPVLAALLDAALERARANAQHADTATRVRLHPGDLCHLLPELDATS
REVVYIDPMYPDGSTRGAVGRPAQVLRALHADARGPDEDQLLAAALGHATRRVVVKRPQR
AAPVAGPPPSRSVAGRAVRFDVYEVNG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcagggttgcgttgcgatgcatcaaccgatccgggcctgtgcggggtggtcgcc
gtcggcgaccaccccgccgcagccgccgcctgggccgagcagctcggggtaccggtgctc
gaacaccggccccaggaaggctctggggtgatcctgctcgctgacgagccgccggcgctg
cagttgctcggccgtcgggcccccggtccggtggccatcgacttcaccgaccatcagctc
cagcgccgggtcgccggttccaccctgcgccgggacccgctggcccgcgccgtgggcctg
caccggcggccgcagaccgcggtcgtcgacgccaccgccggactcggccacgacggctgg
gtactcgccgccctgggcgcccggatgacctggatcgagcgtagcccggtcctcgccgcc
ctcctggatgcagccctggagcgcgcccgagcgaatgcgcaacacgccgacaccgccacc
cgggtgcgccttcacccgggcgacctgtgccatctgctgccggagctcgacgcaaccagc
cgtgaggtcgtgtatatcgacccgatgtaccccgacggatcgacgcggggcgccgtgggc
cggccggcccaggtcctgcgggcactgcacgccgacgctcggggccccgatgaggatcag
ttgctggctgccgcactggggcacgccacccgccgggtcgtggtcaagcggccacagcgc
gcggccccggtggccggcccgccgccgagccggtcggtcgccggtcgggccgtacgcttc
gacgtctacgaggtcaacggctag

DBGET integrated database retrieval system