KEGG   Halorhodospira halophila: Hhal_2093Help
Entry
Hhal_2093         CDS       T00462                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
hha  Halorhodospira halophila
Pathway
hha00471  D-Glutamine and D-glutamate metabolism
hha00550  Peptidoglycan biosynthesis
hha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Hhal_2093
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hhal_2093
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hha01011]
    Hhal_2093
Enzymes [BR:hha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Hhal_2093
Peptidoglycan biosynthesis and degradation proteins [BR:hha01011]
 Precursor biosynthesis
  Amino acid ligase
   Hhal_2093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C TrkA_N UPRTase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABM62857
UniProt: A1WYU5
Position
complement(2297457..2298800)
Genome map
AA seq 447 aa AA seqDB search
MTASDRQQGYTAVAGLGATGMACVRHLRARGVVVVVVDSRSEPPRLAQLQAEHPEVRVVL
GGLDRDTLFGAERVVVSPGLDLRHGVWTELRAAGRSVVGELTLFAEAVAGPVCAVTGSNG
KSTVVSLLGEMARAAGWDVAVGGNLGTPALELLEQAPADGYLIEVSSFQLEACPGFRADV
AALLNVSADHMDRYDSLDDYAAAKARVLDGARVAVLNAEDPQIAGLGQRADAVRHFNLDG
PADYHLLEQGGRAWLAAAGQPRQAIDELPVPGRAHCANALAAMALADALGIAEVAQCRAL
QAFSGLPHRMESVGEWRGVRWINDSKATNVGAAVAAIGGLHRPVVLIAGGQGKGADFRPL
AQACAESARAVVLIGEDAAAIEAAIAGRVPTERADSMVGAVAAAARWAEPGDAVLLAPAC
ASFDAFSSFEARGDAFRDAVRGEVAHG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaagcgaccgccagcaagggtacaccgctgtcgccggtctcggggcgacgggg
atggcctgtgtgcgccatctgcgcgcccgtggtgtcgtggtcgtggtggtggacagtcgc
agcgagccgccgcgcctggcgcagctgcaagccgagcaccccgaggtgcgggtggtgctt
ggggggctcgaccgcgacaccctgttcggcgccgaacgcgtggtggtcagccccggtctc
gacctgcgccacggggtctggacggagctgcgcgcggccgggcggtcggtggtgggggaa
ctcaccctgttcgccgaggcggtggcgggtccggtgtgcgccgtaaccggttccaatggc
aagagcacggtggtcagcctgctcggcgagatggcccgcgctgccgggtgggatgtggcc
gtgggcggtaatctggggacgcccgccctggagttgctcgagcaggcgcccgccgatggc
tacctgatcgaggtgtccagcttccagctggaggcgtgccctggcttccgcgccgatgtg
gcggcgctgctcaacgtcagcgccgaccacatggaccgctacgacagcctcgatgactac
gcggcggccaaggcacgggtgctcgacggcgcccgggtggcagtgctcaacgccgaggat
ccccagatcgccggcctggggcagcgggcggacgccgtgcgccatttcaacctcgacggc
ccggccgactaccacctgctcgagcagggcggccgtgcctggctcgccgccgccgggcag
ccccgacaggccatcgatgagctgccggtacccggccgcgcccactgcgccaacgccctg
gccgccatggccctggccgatgccctggggattgccgaggtggcccagtgccgggcgctg
caggccttctccgggttgccgcatcgcatggagtcggtgggtgagtggcgcggggtgcgc
tggatcaacgactccaaggcgaccaacgtcggtgctgcggtggccgccatcggcggcctg
caccgaccggtggtgctgatcgccggcgggcagggcaagggggccgacttccggccgctg
gcccaggcctgtgccgaatcggcgcgtgcggtggtcctcatcggcgaggacgcagcggcc
atcgaggcggccatcgccgggcgcgtccccaccgagcgggccgacagcatggtcggcgcg
gtggcggccgctgcccgctgggccgagcccggcgatgccgttctcttggcaccggcatgc
gccagttttgacgccttcagcagcttcgaggcacgcggcgatgcgttccgtgacgccgtc
cgcggggaggtggcccatggctga

DBGET integrated database retrieval system