KEGG   Halobacterium hubeiense: Hhub_1544Help
Entry
Hhub_1544         CDS       T04202                                 

Gene name
gdh
Definition
(GenBank) glucose 1-dehydrogenase
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
hhb  Halobacterium hubeiense
Pathway
hhb00030  Pentose phosphate pathway
hhb01100  Metabolic pathways
hhb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hhub_1544 (gdh)
Enzymes [BR:hhb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Hhub_1544 (gdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N ADH_N_2
Motif
Other DBs
NCBI-ProteinID: CQH49625
UniProt: A0A0U5H0L7
Position
I:complement(519009..520076)
Genome map
AA seq 355 aa AA seqDB search
MDAIAVTRDDPTPRVVDLPRPEPEPGEALVRTLRVGVDGTDHEVIAGGHGGFPDGDDHLV
LGHEAVGVVEDPNGTDLDAGGVVVPTVRRRPNGGNEFFERGEPDMAPGGKYYERGIEGAH
GFMAEYFTSPAEFLVEIPADLAERGFLVEPVSISEKGFEHAFASRSAFDWHPESALVLGN
GSLGLLTLAMLEADDRFERTYCLGRRDRPDPTIDLIEDLGATYVDSRETPVPDVPAAHEP
MDFVYEATGYPKHAFETIDALAPNGVGALLGVPEDWDFEVGGGRLHREFVLHNKALVGSV
NSGVQHFEDAVDTLRSLPEWLFDDLVTGVYGLDEFERAFVDDETTIKTAVQFDSR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaatcgccgtcacccgcgacgacccgacgccgcgcgtcgtcgacctgccgcgg
cccgagcccgaaccgggcgaggcgctcgtgcgcacgctccgcgtcggcgtcgacggcacc
gaccacgaagtcatcgcgggcggccacggcggcttccccgacggcgacgaccacctcgtg
ctcggccacgaggccgtcggcgtcgtcgaagaccccaacggcaccgacctcgacgccggc
ggcgtcgtcgtgccgacggtccgccgccgaccgaacggcggcaacgagttcttcgagcgc
ggcgaacccgacatggcgcccggcggaaagtactacgagcgcggcatcgagggcgcccac
gggttcatggccgagtacttcaccagccccgcggagttcctcgtggagattcccgcggac
ctcgccgagcgcgggttcctcgtcgaacccgtcagcatctccgagaagggcttcgagcac
gcgttcgcctcgcggtcggcgttcgactggcatcccgagagcgcgctcgtcctcgggaac
ggctcgctgggcctgctcacgctcgcgatgctggaagccgacgaccgcttcgagcgcacg
tactgcctgggccgccgcgaccgccccgaccccaccatcgacctcatcgaggacctcggc
gcgacgtacgtcgactcccgggagacacccgtgcccgacgtccccgccgcacacgagccg
atggacttcgtctacgaggccaccggctaccccaaacacgccttcgagaccatcgacgcg
ctggcgcccaacggcgtcggcgcgctcctcggcgtccccgaggactgggacttcgaggtc
ggcggcggccgcctccaccgcgagttcgtcctccacaacaaggcgctggtcggcagcgtc
aactccggcgtccagcacttcgaggacgccgtcgacaccctccggtcgctcccggagtgg
ctgttcgacgacctcgtcaccggcgtctacggcctcgacgagttcgagcgagcattcgtc
gacgacgaaacgaccatcaagacggcggttcaattcgacagtagatga

DBGET integrated database retrieval system