KEGG   Halobacterium hubeiense: Hhub_5102Help
Entry
Hhub_5102         CDS       T04202                                 

Definition
(GenBank) transport protein (probable substrate phosphate/sulfate)
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hhb  Halobacterium hubeiense
Brite
KEGG Orthology (KO) [BR:hhb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Hhub_5102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CQH64616
UniProt: A0A0U5D2B3
Position
pSTJ002:complement(81507..82682)
Genome map
AA seq 391 aa AA seqDB search
MDPALIALFVGAALASLFMAWVIGAGSSGATPYAPAVGANAISTMRAALLVGLFGFVGAV
TQGGNVSEAIGSGLVGGISLPIAGVILVLVLGAGLMAVGITTGYPIATAFTVTGAVIGVG
LALGGSPVWPKYQQIAAVWVLTPFVGGGIAFTIASLLPRPDVPERYSIPVLTGLVGAVLM
NVQFSFLGTGSAAGTVRGVGQQVLAIDGLVSAVGITGLAALAVAAVVWWDVRRDERGGLR
RVLLALGSLVAFSAGGSQVGLAVGPLLPLLDEVGMVSTFTVLVGGGLGMLVGSWTGAPRM
IKSLAQDYSSLGPRRSISALVPSFLIAQLAVLLGVPVSFNEIVVSAIIGSGAAVGGWEAV
DARKIGVTVGAWAGSFTLSFALAYAIGLVFL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgctcttatcgccctcttcgtcggtgcagcgctggctagcctgttcatggcg
tgggttatcggcgccggctcaagtggggcgacgccgtatgcccctgccgtcggggcgaac
gctatctcgacgatgcgtgccgccctcctcgtcggtcttttcggctttgtcggcgccgtc
acacagggcggcaacgtctcggaagccatcgggagcggcctcgtcggtggaatcagtctc
ccgatcgctggcgtcatcctcgtactcgtgttgggtgcggggctgatggcggtcggcatc
acgaccggctatccgattgcgactgcgttcacggtgaccggcgccgtcatcggcgtcggc
ctcgcgctgggcggctcgccggtctggccgaagtaccagcagatcgccgccgtctgggtg
ttgacgccgttcgtcggcggcggcatcgcgttcaccatcgcaagcctgctcccgcgcccc
gacgtccccgaacggtacagtatccccgtgctcaccgggctcgtcggagcggttctcatg
aacgtccagttcagcttcctcggtacggggagcgcggcaggcaccgtccgcggtgtcgga
cagcaggtgctggcaatcgacggactcgtgtcggcggtcgggattactggcctcgcagcg
ctggccgtcgcagcagtcgtctggtgggacgtccgccgcgacgaacgcggcggcctgcgt
cgggtgttgctggcgctcgggtcgctcgtggcgttctctgcgggcgggagtcaggtcggg
ctcgccgttggaccgctgctgccgttgctcgacgaggtcgggatggtctcgacgttcacc
gtgctcgtcggtggcggtttggggatgctcgtcgggtcttggacgggtgcgccgcggatg
atcaagtcgctcgcccaggactactcatcgctggggccgcggcgctccatctcggcgctc
gtgccgtcgttcctgatcgcacagctggcagtgctgcttggcgttccggtctcgttcaac
gagatcgtcgtcagcgccattatcgggagtggcgccgctgtcggcggttgggaagcagtg
gatgcccggaaaatcggtgtgacggtgggtgcctgggcaggatcgttcacgctctcgttc
gcgcttgcgtatgcgataggtcttgtatttctgtag

DBGET integrated database retrieval system