KEGG   Ectothiorhodospira haloalkaliphila: M911_03755Help
Entry
M911_03755        CDS       T03059                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
hhc  Ectothiorhodospira haloalkaliphila
Pathway
hhc00230  Purine metabolism
hhc00250  Alanine, aspartate and glutamate metabolism
hhc01100  Metabolic pathways
Module
hhc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:hhc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    M911_03755
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M911_03755
Enzymes [BR:hhc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     M911_03755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AHK78443
UniProt: W8KGZ2
Position
761857..763149
Genome map
AA seq 430 aa AA seqDB search
MSKFVVVLGSQWGDEGKGKVVDLLTEEAAAVVRFQGGHNAGHTLVIDGRKTVLHLIPSGI
LRDNVQCLIGNGVVLSPEALMKEMAMLEKNGVPVRERLRLSESCQLILPYHVMLDQAREK
ARGNAAIGTTGRGIGPAYEDKVARRGLRLGDLFHRERFAAKLGEVLDYHNFVLKHYFKAE
TLDFQAVLEHSLAVAEELAPMIMDVPERLRQLREQGASVMFEGAQGTLLDIDHGTYPFVT
SSNTTAGGVCTGSGVGPLDLDYVLGITKAYTTRVGAGPFPTELFDAMGEHLAHRGHEFGS
TTGRPRRCGWFDAVALKRAVAINSISGLCVTKLDVLDGLETLQVCVGYRCGDVVHTEPPA
GADAYAECEAIYEELPGWQESTVGVTDYDQLPANARTYLERIQEVSGVPVDMISTGPDRG
QTILKRHPFA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattcgtggtggtcctgggcagtcagtggggcgatgaaggcaagggcaaggtg
gtggatctgctcaccgaggaagccgctgccgtggtgcgttttcagggtgggcacaatgcc
ggccataccctggtgatcgacggtcgcaagacggtgctgcacctcatcccctcgggcatc
ctgcgcgacaatgtgcagtgcctgatcggcaatggcgtggtgctctcccccgaggcgctg
atgaaggaaatggccatgctggagaagaacggcgtgccggtgcgtgagcgcctgcgcctg
tccgaatcctgccagttgatcctgccctaccatgtcatgctggaccaggctcgtgaaaaa
gcccgtggcaatgccgccatcggtaccactggtcggggcatcggcccggcctacgaggac
aaggtggcgcgccgcggtctgcgcctgggggatctgttccaccgggagcgcttcgccgcc
aagctgggtgaggtgctcgactatcataactttgtgctcaagcactatttcaaggccgag
accctggacttccaggcggtgctggaacactccctggcagtggccgaagagctggccccg
atgatcatggatgtgcccgagcgcctgcgccagctgcgcgagcagggggcatcggtcatg
ttcgagggggcccagggcaccctgctggacatcgaccatggcacctatcccttcgtgacc
tcttccaacaccactgccggtggcgtgtgcaccggcagtggcgtgggtcccctggatctg
gattacgtgcttggcatcaccaaggcctataccacccgtgtgggcgccggtccgttcccc
accgaactgttcgatgccatgggcgagcacctggcccatcgtggccatgaattcggttcc
actacgggtcggccacgtcgttgtggctggttcgatgccgtggccctcaagcgcgcggtg
gccatcaacagcatcagtggcctgtgcgtcaccaagctggacgtgctggacggcctggaa
accctgcaggtctgcgtgggctaccgctgtggtgacgtggttcacaccgagccgccagca
ggcgccgatgcctacgccgaatgcgaggccatctacgaggagctgccgggctggcaggag
tccaccgtcggggtcaccgactatgaccaattgcccgccaacgcccggacctatctggag
cgtatccaggaggtgtcaggagttcccgtggacatgatctccactggcccggaccgcggt
cagaccatcctcaagcgccatccgttcgcttaa

DBGET integrated database retrieval system