KEGG   Ectothiorhodospira haloalkaliphila: M911_05165Help
Entry
M911_05165        CDS       T03059                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
hhc  Ectothiorhodospira haloalkaliphila
Pathway
hhc00790  Folate biosynthesis
hhc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M911_05165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hhc04147]
    M911_05165
Enzymes [BR:hhc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     M911_05165
Exosome [BR:hhc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M911_05165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AHK78660
UniProt: W8L439
Position
complement(1052545..1052886)
Genome map
AA seq 113 aa AA seqDB search
MNESLSQKQCVPCEGGVAPLDESAAKGMMDKLANDWQLSEDARTLSRTVRFRNYHETMAF
VNAVAWIAHQQDHHPDMAVSYNQCRVDFATHAIGGLSENDFICAAKVDQLLHT
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagtcactgagccagaagcaatgcgtaccctgcgaaggtggggtcgcccctctt
gatgagagcgcagccaagggaatgatggataagctcgccaacgattggcagctatccgag
gacgccaggacattgagccgcacggtgcgctttcggaactatcatgaaactatggcattc
gtgaatgccgtggcctggattgcccaccagcaggatcatcacccggacatggccgtaagt
tacaatcaatgccgggtggatttcgccacccatgccattggcggcctgtcggagaatgat
ttcatctgtgccgccaaggtggatcagctgctgcacacttag

DBGET integrated database retrieval system