KEGG   Halorhodospira halochloris: M911_05900Help
Entry
M911_05900        CDS       T03059                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
hhc  Halorhodospira halochloris
Pathway
hhc00860  Porphyrin and chlorophyll metabolism
hhc01100  Metabolic pathways
hhc01110  Biosynthesis of secondary metabolites
Module
hhc_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:hhc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M911_05900
Enzymes [BR:hhc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     M911_05900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AHK78778
UniProt: W8KHY0
Position
1205161..1206543
Genome map
AA seq 460 aa AA seqDB search
MSQSIDFDLDLINRYNTAGPRYTSYPTAVQFHEGFGAERYAEIARETNASGRPLSLYFHI
PFCDTVCFYCACNKVVTKDRTKAKPYLDRLYKEMAMQGALFDKNRPVTQLHWGGGTPTFI
SHDEMTELMGKTAEHFGLLDDDTGEYSIEIDPREVDDSTLGLLRKLGFNRISLGVQDFDE
KVQKSVNRVQSESLVLGVLEEARSLGFRSTSVDLIYGLPHQDRKTFGDTIEKIIKVDPAR
ISVFNYAHLPDRFKPQRRIEEEALPSPGEKLAMLQQTIQQLTEAGYVYIGMDHFAKPDDE
LAVAQRDHTLYRNFQGYSTHSNCDLVGLGSTSVGVVGNSYSQNHHDLEKYFQCIDDGKLA
VFRGVELDADDVLRRDVITRLICHFELAFEDVEKVHGIKFTDYFARELKELKPMEDDGLL
KVSGNTITVQPAGRLLIRNICMTFDRYLREATEQRFSRVI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcagagcattgatttcgatctggacctgatcaaccgttacaatacggcgggtcct
cgatacacatcctatcccacggcggtgcagttccacgaaggtttcggggcggagcgctac
gcggagatcgcccgggagaccaatgccagcgggcgtccgctgtcgctgtatttccacatc
cccttctgcgacacggtgtgcttctactgcgcctgtaacaaggtggtcaccaaggaccgc
accaaggccaagccctatctggaccgtctctacaaggaaatggccatgcagggcgcgctg
ttcgacaagaaccgtccggtgacccagttgcactggggcggcggcacgcccaccttcatc
tcccacgacgagatgaccgagctgatgggcaagaccgccgagcacttcgggctgctggat
gacgacaccggcgagtattccatcgagatcgacccgcgggaagtggacgacagcaccctg
ggtctgctgcgcaagctgggtttcaaccgcatcagcctgggcgtgcaggacttcgacgag
aaggtgcagaaatccgtcaaccgggtgcagagtgagtcgctggtgctgggtgtgctggaa
gaggccagaagcctgggcttccgctccaccagtgtggacctgatctacggcctgccccat
caggatcgcaagaccttcggcgataccatcgagaagatcatcaaggtggatccggcccgg
atctcggtgttcaactacgctcacctgccggaccgcttcaagccccagcgccgcattgaa
gaagaggcactgcccagccccggcgagaagctggccatgctgcagcagaccatccagcag
ctcaccgaggccggttatgtgtatatcggcatggaccacttcgccaagcccgatgacgaa
ctggccgtggcccagcgagaccacaccctctaccgtaacttccaggggtattccacccac
tccaactgtgatctggtgggcctgggttccaccagtgtgggcgtggtgggcaacagctac
agccagaaccatcatgacctggagaagtacttccagtgcatcgatgacggcaagctggcg
gtcttccgcggggtggaactggatgccgacgatgtactgcgccgcgatgtgatcacccgt
ctgatctgccacttcgaactggccttcgaggacgtggaaaaggtgcacggcatcaagttc
acggactacttcgcccgtgaactcaaggaactcaagccaatggaagacgatggtctgctc
aaggtctccggtaacaccatcaccgtgcagcccgccggtcgtctgctgatccgcaacatc
tgcatgacctttgaccgttatctgcgtgaggccacggaacagcgcttctcccgcgtgatc
tga

DBGET integrated database retrieval system