KEGG   Halorhodospira halochloris: M911_08230Help
Entry
M911_08230        CDS       T03059                                 

Definition
(GenBank) light-independent protochlorophyllide reductase subunit N
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
hhc  Halorhodospira halochloris
Pathway
hhc00860  Porphyrin and chlorophyll metabolism
hhc01100  Metabolic pathways
hhc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M911_08230
Enzymes [BR:hhc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     M911_08230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: AHK79144
UniProt: W8KHB1
Position
complement(1699084..1700376)
Genome map
AA seq 430 aa AA seqDB search
MTVPVQPSSSAGPEQTVDFNIIRERGPHAVFCGLTSIIWLHRKIQDAFFLVVGSRTCAHL
MQSAAGVMIFAEPRFGTALIEERDLAGLADANEELDRVVARLLERRPDIRMLFLVGSCPS
EVIKLDLERAASRLSQQHMPQVRVLNYTGSGIETTFTQGEDTCLAALVPELPRETDADPA
SLLVVGSLADIVEDQFTRLFAEMGIHDVRYLPARRSDQLPAVGPNTRYILAQPFLNEAAR
ALEGLGATRLSAPFPLGVEGTTGWLRAAADAFGVDPALFDKVTAPGIERARRGLSHIAEE
LKGKRIFLFPDSQLEIPLARFLHREAGMELVEVGTPYLHRQHLAEELAMLPKDTCLSEGQ
HLDKQLDRCREAHPDVVVCGLGLANPLEAEGMTTKWSIELVFTPIQGYDQAADLAELFAR
PLMRRAKLRV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttccagtgcaaccttccagcagcgccggtcctgagcagacggtggacttcaac
atcatccgcgagcgcggcccgcatgcggttttctgcggtctgaccagcatcatctggctg
catcgcaagattcaggatgcctttttccttgtggtgggttcgcgcacctgtgcccacctg
atgcaatcggcggccggcgtcatgatctttgccgaaccccgcttcggcacggcgctgatc
gaagagcgcgacctggccgggctggcggatgccaacgaggaactggaccgcgtcgtggcg
cggctgctggagcgtcgcccggatatccgcatgctgttcctggtgggttcctgcccttcc
gaagtcatcaagctggatcttgaaagggccgcctcccgcctgtcccagcagcacatgccc
caggtacgggtactcaactacaccggcagcggcatcgagaccactttcacccagggcgag
gacacctgcctcgccgccctggtgccggaactcccccgggagaccgacgccgatcccgcc
tccttgctggtggtgggttcgctggcggatatcgtcgaggatcagttcacccgcttgttc
gcggagatgggcatccatgacgtgcgctacctgccggcccggcgttccgatcaattgccg
gcggtggggccgaacacacgttatatcctggcccagcccttcctcaatgaggcggcgcgc
gccctggaggggctgggtgccacacgtctgtcagccccgttcccgcttggggtggaaggc
acgaccgggtggttgcgggccgcagccgatgccttcggtgtggatccggcgctattcgat
aaagtcaccgcaccaggtattgagcgggcacggcgcggtctgtctcatattgccgaggag
ctcaagggcaagcgcatcttcctgttcccggactcccagctggaaatccccctggctcgc
ttcctgcaccgtgaagcgggcatggaactggtggaggtgggcacgccctacctgcatcgc
cagcacctggccgaggagctggccatgctgccaaaggacacctgcctgagcgaaggacag
cacctggacaagcagctggaccgctgccgcgaggcacacccggacgtcgtggtctgcggc
ctgggcctggcgaatccgctggaggcagaaggcatgacaaccaagtggtcgatcgaactg
gtcttcaccccgattcagggctacgatcaggcggccgatcttgctgaactgtttgcccgg
ccgctgatgcgccgagccaaattgagggtctga

DBGET integrated database retrieval system