KEGG   Ectothiorhodospira haloalkaliphila: M911_13625Help
Entry
M911_13625        CDS       T03059                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
hhc  Ectothiorhodospira haloalkaliphila
Brite
KEGG Orthology (KO) [BR:hhc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    M911_13625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: AHK80019
UniProt: W8KJP7
Position
2820948..2821331
Genome map
AA seq 127 aa AA seqDB search
MPASSEHPIRVDVKSTYVESQSDPMHGRFVFAYTVTIHNQGQQPAKLISRHWIIHDSNGK
VQEVRGEGVVGEQPHLQPGQGFKYTSGAMIETPVGTMQGSYRMVGDDGVEFDAPIPSFTL
SVPRVLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccggcaagcagcgaacacccgatccgggtcgatgtaaagagcacctatgtggaatcc
cagtccgaccccatgcacggacggtttgtcttcgcctacacggtgaccatccacaaccag
ggccaacaacccgccaagctgatcagccgccactggatcatccacgactccaacggcaag
gtgcaggaggtgcgcggagagggcgtggtgggtgaacaaccccatctgcagccgggccag
ggcttcaaatataccagtggcgccatgatcgagacaccggtgggcaccatgcagggcagt
taccggatggttggagacgatggtgtggagttcgatgcccccattccctccttcaccctg
tcggtccctcgcgtattgcactga

DBGET integrated database retrieval system