KEGG   Halobacillus halophilus: HBHAL_2031Help
Entry
HBHAL_2031        CDS       T02031                                 

Definition
(GenBank) 3-oxoacid CoA-transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00072  Synthesis and degradation of ketone bodies
hhd00280  Valine, leucine and isoleucine degradation
hhd00650  Butanoate metabolism
hhd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HBHAL_2031
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    HBHAL_2031
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HBHAL_2031
Enzymes [BR:hhd01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     HBHAL_2031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans DeoRC AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: CCG44392
UniProt: I0JJS3
Position
1040753..1041415
Genome map
AA seq 220 aa AA seqDB search
MDKAAVRERIARRAEQEIESGYYVNLGIGMPTMVANYIQPEKEVVLHSENGLVGIGRSPY
KEEVDPDLINAGKETVTASKGASYCSSAESFAMIRGEHLDLAILGGMEVSEDGSLANWMI
PGKMIKGMGGAMDIVHGARKVVIIMDHVNKYGEPKILKQCKLPLTGKGIVNRIITDRAVI
DVTDEGLTLVEVAEGWTVDDVVASTEPSLKLSEHLSSAAF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttggataaagcagcagtaagagaacgaatcgcccgaagagctgaacaggaaattgaaagc
ggttactatgtgaatttagggatcggcatgcctacgatggtcgcgaattatattcagccg
gaaaaagaggttgtacttcattctgaaaacggactggttggcatcggccgctcaccttat
aaagaagaagtagatccagatctaattaatgccggtaaggaaacggtcaccgcttcgaaa
ggggcttcctactgcagcagtgctgagtcctttgccatgattcgcggtgaacatctagat
ttagccattctaggtgggatggaagtctcggaagatggaagcttagcgaactggatgatc
ccgggcaagatgattaaaggcatgggaggagctatggatattgtccacggagccagaaaa
gtggtcatcattatggatcatgtgaacaaatatggcgagccgaagatattgaagcagtgt
aagcttcccctgaccggtaaaggcattgtgaaccgcattatcaccgatcgcgccgtgatc
gacgtaacggatgaaggcctgaccttagtggaggtagccgaaggatggacggtggatgac
gtagtagcatctacagaaccatcactgaagcttagtgagcatttatcatcagctgctttt
taa

DBGET integrated database retrieval system