KEGG   Halobacillus halophilus: HBHAL_2410Help
Entry
HBHAL_2410        CDS       T02031                                 

Definition
(GenBank) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00020  Citrate cycle (TCA cycle)
hhd00620  Pyruvate metabolism
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
hhd01130  Biosynthesis of antibiotics
hhd01200  Carbon metabolism
Module
hhd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hhd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hhd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HBHAL_2410
   00620 Pyruvate metabolism
    HBHAL_2410
Enzymes [BR:hhd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     HBHAL_2410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase Pyr_redox Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CCG44755
UniProt: I0JKT5
Position
complement(1408620..1410116)
Genome map
AA seq 498 aa AA seqDB search
MNHNHTTSDVILIGAGVVSATLATLLHKLEPEWRITLFEKLDSAGQESSNEWNNAGTGHA
ALCELNYTPEQPDGSLDISKAVKINEQFQVSRQMWAHLVEQGDLQNPEDFIRPLPHISFV
YGKDHVEFLTKRVEALKDHPQFQGMEFTIDPERIKEWIPLMMEGRSTEEPIAATKFDHGT
DVNFGELTRQMLKHLEKQDNIEIRYNHSVDDIQQRADGAWEVKVRNLKEETIEEHTSSFA
FIGAGGGALPLLQKTGIPESKRIGGFPISGEFLVCDNPEVVKQHHSKVYGKEPAGTPPMT
VPHLDRRHIEGKDTLLYGPFAGFTPKFLKTGSMMDLFGSVKPTNVLTMLAAGAKNTSLIK
YLAMQLKMSKKDRMEELRNFVPNASNEDWDLLVAGQRVQLIEDTEEGGRGALQFGTKLIH
AEDRTMAALLGESPGASVSVSIMLEVLHKCFPEYRESWDPKLKEIIPSYGESLEDNPELL
ERVHDSTSRTLGLLEPVK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaatcataaccacacaacgagtgacgtgatcctgatcggtgcaggtgtcgtgagcgcg
acactggccacgcttctgcacaaattagaaccggaatggcgcatcaccctgttcgagaag
ctcgactccgccggacaggaaagttctaatgaatggaataatgccggaaccggacacgcc
gctctctgcgaactgaactatacacctgaacagccggacggctccctggacattagcaag
gcggtaaaaatcaacgaacaattccaggtttccagacaaatgtgggcccacctggtcgag
cagggcgatcttcagaatcctgaagattttatccgtcccttgcctcacataagctttgtt
tacggtaaagatcacgtagaatttttgacgaagcgggttgaagccctgaaagatcatcct
cagtttcaggggatggagtttaccatagaccccgaacgcatcaaggaatggattccttta
atgatggagggccgttccactgaagagccgatcgcggcaacgaaattcgaccatggcaca
gatgttaattttggagaactaactcgtcaaatgctgaaacacttagagaagcaagacaat
atagagatccgttacaatcattccgtcgatgatattcaacaaagagcagacggagcatgg
gaagttaaagtacgaaaccttaaagaagaaaccatcgaagagcatacctcttccttcgcc
tttatcggtgcaggtggcggcgccctgccattgctgcaaaaaacaggcattcccgaaagc
aagcgcatcggcggatttccgatcagcggtgaattcctcgtctgtgacaacccggaagtc
gtgaagcagcaccattccaaagtatatggaaaagaaccggccggcactccgccgatgact
gtcccgcacctggaccgtcgccatattgaaggaaaagacacgctgttgtacggaccgttc
gccgggtttacacctaaatttttgaaaaccggatcgatgatggatctgttcggttcggtg
aagccgacaaatgtgctgacaatgctcgcagccggcgcaaaaaacacctccctgatcaaa
tatttggcaatgcagctgaagatgtccaaaaaggaccggatggaagagctgcggaatttt
gttccgaatgcatccaatgaagactgggacctgctcgtagccggacagcgcgttcaattg
attgaggatacagaagaaggcggccgcggtgctctccagttcggtaccaaattgattcac
gcagaagaccgtaccatggcggctcttcttggcgaatcaccaggggcatcggtttccgtt
tccattatgctcgaggtcttacacaagtgcttcccagagtatcgtgagtcctgggatccg
aagctgaaagaaatcatcccttcctacggcgaatccctggaggataaccctgagctgctg
gagcgggttcatgattctacctcacgcacccttggtttgctggagcctgtaaaataa

DBGET integrated database retrieval system