KEGG   Halobacillus halophilus: HBHAL_2602Help
Entry
HBHAL_2602        CDS       T02031                                 

Gene name
fbp1
Definition
(GenBank) fructose 1,6-bisphosphatase, class III
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00010  Glycolysis / Gluconeogenesis
hhd00030  Pentose phosphate pathway
hhd00051  Fructose and mannose metabolism
hhd00680  Methane metabolism
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
hhd01130  Biosynthesis of antibiotics
hhd01200  Carbon metabolism
Module
hhd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_2602 (fbp1)
   00030 Pentose phosphate pathway
    HBHAL_2602 (fbp1)
   00051 Fructose and mannose metabolism
    HBHAL_2602 (fbp1)
  Energy metabolism
   00680 Methane metabolism
    HBHAL_2602 (fbp1)
Enzymes [BR:hhd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     HBHAL_2602 (fbp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: CCG44948
UniProt: I0JLC8
Position
1605973..1607904
Genome map
AA seq 643 aa AA seqDB search
MNTKYLDLLAQKYDSEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGK
VKEKITDLFAEELSEKEMNEFATLVYYPEEKIRLIKNSFDNEKELNHWYGQIIERMLKLV
SYASSKYTRSKLRKALPSQFAYVIEELLYKTDEFTNKEQYYSKILQQIISLGQSDKLIIG
LAYTTQQLVVDHLHVVGDVYDRGPEPDKIMETLINYHSIDIQWGNHDVLWIAAYAGSKVC
LANIIRICARYNNLEIIEDAYGINLRPLLNLAEKYYDDNPAFRPKINPGEEPSDHERLQI
TKIHQAIAMIQFKLESPIIKRRSYFNMEDRLLLEKVDYDRNEITIHGETYPLEDTCFATV
DPEHPEQLLEEEEQVMEKLLFSVQHSEKLARHMNFFMKKGSLYLKYNGNLLIHGCIPLDE
QGNMEKMTIENRTYGGRELLDVFEHYLRYAFAHPEKTDDLATDMSWYLWTGEYSSLFGKR
EMTTFERYFIKDKKVHKERKNPYYHLREDEETCREILTDFGLNPDQGHIINGHTPVKEID
GENPIKANGKMIVIDGGFSKAYQSKTGIAGYTLLFNSYGMQLVAHQHFNSKEEVLRNGTD
VLSVKRLVDKELERKKVLETNVGEELLQEIYILNSLMEYRYIN
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
ttgaatacaaaatacctggacttactcgcccaaaaatatgatagtgaagaaaaagtggtc
actgaaattattaatcttaaagctatacttaatctgcccaaaggcacagagcattttgtc
agcgatttgcacggggagtatcaagcctttcaacatgtattaagaaatggttcagggaaa
gtaaaagagaaaatcaccgatctatttgccgaagagttatccgaaaaagaaatgaatgag
ttcgcgacgctagtctattacccagaagaaaagatcaggctgatcaaaaacagctttgat
aatgaaaaagaattgaaccattggtatgggcaaatcatcgaacgtatgttgaagcttgtt
tcatatgcttcctccaaatatacccgatccaaacttcggaaagccttacccagccagttt
gcgtacgttattgaagagctgctttacaaaacagatgaattcaccaataaggagcagtat
tattctaagattcttcagcagattatctccctcggccagtcggataagctcatcatcggt
ctcgcttataccacccagcagctggtggtggaccatcttcatgtcgtgggagatgtgtat
gatcgaggtcccgaacctgacaaaatcatggaaaccctcattaattatcactcgattgat
attcagtgggggaatcatgatgtcctatggattgcagcctatgcaggctcaaaggtctgt
ctcgctaatatcattcgaatctgcgcacgctacaacaatttagagattatcgaagatgcg
tatggaattaatcttagaccgcttcttaatcttgcagagaaatactatgacgacaatcct
gccttccgtcctaagatcaatccaggcgaagaaccatctgatcatgaaagattacaaatt
acgaagattcaccaggccattgccatgattcagttcaaactggaaagccctattatcaaa
agacgctcctatttcaatatggaagatcgacttttgcttgagaaagtagattacgacagg
aatgaaatcaccatccacggggaaacctacccccttgaagatacctgctttgccacggtg
gatcctgagcatcctgaacagcttctagaggaagaagagcaagtgatggagaaactatta
ttctctgttcagcattcagaaaagctggccagacacatgaactttttcatgaaaaaagga
agtctttatctgaaatataacgggaacttattaattcatggatgcattccgctggatgaa
caaggaaacatggaaaaaatgacgattgaaaatcgaacctatggcggaagagaattactt
gatgtttttgagcactatctacgttacgcttttgcccatcctgaaaagaccgacgatctt
gcaacggacatgtcctggtatttatggacaggggaatattcctctcttttcgggaaacgg
gagatgaccacgttcgaaaggtactttattaaagataagaaagtccataaagaaagaaaa
aacccttattatcatttgcgggaagatgaggagacctgccgggaaatactcactgacttt
ggtctgaatccagaccaggggcatatcatcaatggccacacaccggttaaagaaatagat
ggggaaaatcccattaaagccaatggaaagatgattgtaatcgacggaggattttccaag
gcttatcaatccaaaacgggcatagccggctacacgttattatttaattcctacggcatg
cagctggttgctcaccaacactttaattctaaagaggaagtgctgcgaaatggaacggat
gtcttatcggtgaaaagattggtggataaggagcttgagaggaaaaaggttcttgaaaca
aatgtgggagaggaattactgcaggaaatttatattttgaacagtttgatggaatatcgt
tatataaattga

DBGET integrated database retrieval system