KEGG   Halobacillus halophilus: HBHAL_2971Help
Entry
HBHAL_2971        CDS       T02031                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00010  Glycolysis / Gluconeogenesis
hhd00071  Fatty acid degradation
hhd00350  Tyrosine metabolism
hhd00625  Chloroalkane and chloroalkene degradation
hhd00626  Naphthalene degradation
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
hhd01130  Biosynthesis of antibiotics
hhd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_2971
  Lipid metabolism
   00071 Fatty acid degradation
    HBHAL_2971
  Amino acid metabolism
   00350 Tyrosine metabolism
    HBHAL_2971
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HBHAL_2971
   00626 Naphthalene degradation
    HBHAL_2971
Enzymes [BR:hhd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HBHAL_2971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Methyltransf_11 PEPcase_2 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: CCG45319
UniProt: I0JME9
Position
complement(1970138..1971172)
Genome map
AA seq 344 aa AA seqDB search
MPHFNHTMKAAVVHDFKQDLEMQDVPVPKVEHGQVLVKVKASGVCHTDLHAAHGDWPVKP
NLPLIPGHEGVGEIVEAGPGVTHVKVGDRVGIPWLYSACGHCEYCLSGRETLCKDQQNAG
YSVNGSYAEYCLAHADYIVKIPDNLTYVEAAPLFCAGVTTYKALKVGNANPGDWVAIYGI
GGLGHVAVQYAKAMGFNVIAVDPFDEKLELAQQLGADRTINPLTENSAEFIQREIGGVQA
SICTAVSKQAFGEAYRAVKRGGKCVAVGLPPETMEVPIFDTVLNGVSIEGSIVGTRKDLQ
ETLQFAAEGKVKTIVETKRLEDINEIFAELEAGKINGRIVLVND
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgccccacttcaaccatacaatgaaggcagctgttgtgcatgattttaaacaagattta
gaaatgcaggatgtacctgtaccaaaagtcgaacatggccaagtactggtgaaagttaaa
gccagtggagtatgtcatacagacttacatgcagcccatggagattggccagtaaagcct
aaccttcctttaatccccggccatgaaggcgtcggtgagattgtagaggccggccccggt
gtcacccatgtaaaagttggcgatcgggtaggtattccgtggctttattccgcatgcgga
cactgtgaatactgcctttcaggacgcgaaacactttgtaaagatcaacagaatgcagga
tattctgttaatggcagttatgctgagtactgtctcgctcatgcagattacattgtcaaa
attccagataatttaacttacgttgaagctgctcctctattctgtgcaggggtgaccact
tacaaggctttaaaggtaggaaatgccaatcctggagattgggtagccatttatggaatt
ggcggccttggacatgtagctgttcaatacgccaaggctatgggatttaacgttatagcc
gttgatccgtttgatgaaaaattagaattggcacaacaattaggtgcagataggaccatt
aacccgctaactgaaaactctgcagagtttatccaacgcgaaatcggaggcgtccaggct
tctatctgtacggctgtttctaaacaagccttcggtgaggcctacagggcagttaaacgt
ggtggtaaatgcgtagcggttggactgcctccggaaacgatggaagttccaatattcgat
acggtgttaaatggagtcagtattgaaggatccattgtcggaaccagaaaggatttacaa
gagactttacagtttgcagctgaaggaaaagtaaaaactatcgttgagacaaaaagatta
gaagatattaatgaaatatttgctgagcttgaagcaggtaaaatcaatggaagaattgta
ttagtgaacgattaa

DBGET integrated database retrieval system