KEGG   Halobacillus halophilus: HBHAL_3070Help
Entry
HBHAL_3070        CDS       T02031                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00900  Terpenoid backbone biosynthesis
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01130  Biosynthesis of antibiotics
Module
hhd_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HBHAL_3070 (dxr)
Enzymes [BR:hhd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HBHAL_3070 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom TFX_C
Motif
Other DBs
NCBI-ProteinID: CCG45417
UniProt: I0JMP7
Position
2061602..2062750
Genome map
AA seq 382 aa AA seqDB search
MMKQITLLGATGSIGLQTLDVIRLHPEEFSLHSMAFGRNIEKALPLIKEFEPRLIVVQDE
ETKKSLAGHVNGTPILTGSGGMIEASVADEVDVVVNAVMGSIGLPATLKAIQAKKLIAIA
NKETLVTAGHLVMAEAHKHNVELLPVDSEHSAIYQSLNGERKEDIHKLIITASGGSFRDN
TREELAGVTVKDALNHPNWSMGAKITIDSASMMNKGLEVIEAHWLFDVPYDQIHVILHRE
SVIHSMVEYVDGSVMAQLGTPDMKVPIQYALTYPERLNLPITKQLNLEEIATLNFEKMDF
ERFPCLRMAYEAGRAGGSMTTVLNAANEEAVQLFLEGKISFLDIEKKIEQSLEMHDRIHN
PDLSTILSIDEETRKRVRFHLN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaaataactttgctgggcgccacagggtctattggcttgcaaaccctggat
gtaatccgcctgcaccctgaagaattctccctccattctatggcctttggacggaatatc
gagaaagccttaccccttatcaaggaatttgaacctcgcttaatagtggtacaggatgaa
gagacaaagaaaagcttagcaggtcatgtgaatggaactcctattcttacaggaagtgga
ggtatgattgaagcgagcgttgcagatgaagtggatgtagtagtaaatgctgtaatggga
agtataggtctcccagcaacactaaaagctatccaggctaagaagttaattgccatcgct
aataaagaaacgctcgtaaccgccgggcatctggttatggcagaagctcataaacacaac
gtagaattattacctgtggatagtgaacactccgctatataccaatccctaaatggtgaa
cgtaaggaagacattcataagttaattattacggcatctggtgggagtttcagggacaac
acaagagaagaacttgcaggagtgacggttaaagatgctttaaatcacccaaactggagt
atgggtgcaaaaattacgattgactctgcttctatgatgaataaagggttagaagtcatc
gaggcgcattggctttttgatgtaccttatgaccagatccatgttattcttcatagagag
agtgtcattcactcgatggtcgagtatgtagatggaagtgtcatggcgcagcttggaaca
cctgatatgaaggtgccgatccaatatgctttaacttatccggaacgactgaatttacct
attaccaaacagcttaatttagaggaaatcgctactctgaactttgaaaaaatggatttt
gagcgctttccatgtctgagaatggcatatgaagcaggacgtgcaggagggtcaatgact
actgtgttgaatgcagcaaatgaagaagccgttcagttgtttttagaaggaaaaatttca
tttctggatatagaaaagaagatcgaacaatctttagaaatgcacgatcgtattcataac
cctgacttgtctaccatactttctattgacgaggaaaccaggaaacgagttcgtttccat
ttaaattaa

DBGET integrated database retrieval system