KEGG   Halobacillus halophilus: HBHAL_3519Help
Entry
HBHAL_3519        CDS       T02031                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00010  Glycolysis / Gluconeogenesis
hhd00052  Galactose metabolism
hhd00500  Starch and sucrose metabolism
hhd00520  Amino sugar and nucleotide sugar metabolism
hhd00521  Streptomycin biosynthesis
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
hhd01130  Biosynthesis of antibiotics
hhd01200  Carbon metabolism
Module
hhd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hhd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_3519
   00052 Galactose metabolism
    HBHAL_3519
   00500 Starch and sucrose metabolism
    HBHAL_3519
   00520 Amino sugar and nucleotide sugar metabolism
    HBHAL_3519
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HBHAL_3519
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HBHAL_3519
Enzymes [BR:hhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HBHAL_3519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FGGY_N Pan_kinase FtsA
Motif
Other DBs
NCBI-ProteinID: CCG45864
UniProt: I0JNZ4
Position
complement(2482621..2483577)
Genome map
AA seq 318 aa AA seqDB search
MEKNIFLAADIGGTTVKLAVIKDSGEIVKKWEINTDRENGGERIPEDIHHAFEDSLEELH
IDKNQVAGIGAGAPGFVDPNSGFIHEAVNIGWKNYDFGAILSEWTGFPVWVDNDANLAAL
GEKWLGAGEGARELIAVTLGTGVGGGIIANGEILNGVNGTAGEIGHITVVPEGGAPCNCG
KTGCLETLASATGIVRLAKESIETIPASILRNIPSDQLTAKDVFEAAQQGDEAAGAVIEK
VTDLLGMTIANLAIAINPEKIVIGGGVSQAGSQLLDPLKVAYKKYALRRTFAATSFDLAK
LGNDAGVIGAAFLVKTNQ
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaatatttttcttgccgctgatatcggcggtactacggtgaaactcgcagtg
attaaagacagtggggaaattgttaaaaaatgggaaattaatacagatagagaaaatggt
ggagagaggatccctgaagatattcatcatgcctttgaggattctttagaagagttacat
attgataagaatcaagtcgccggtattggtgccggagcaccaggttttgttgatccaaat
agcggttttatccacgaagcagtaaatatcggttggaaaaattatgattttggggccata
ttgagtgaatggaccggttttcctgtatgggtggataacgatgccaatcttgcagcttta
ggagaaaagtggctgggagctggtgaaggagcccgtgaactaattgctgtaaccttaggc
actggtgttgggggaggtattatagctaatggcgagattttaaacggagttaatggtacc
gcaggtgaaattggacatattacagtagtacctgaaggcggagctccttgtaattgcggt
aaaactggctgcctggaaacgttagcttcagccacaggaattgttagattagcgaaagag
agtatcgaaactattcctgcaagcatcttacgaaacatcccgtctgatcagctgacagca
aaagatgtatttgaagctgcacagcagggagatgaagcagcaggtgcagtgattgaaaaa
gttacggacctgctgggaatgacaattgccaatcttgctattgcgattaatcctgaaaaa
attgtaataggcgggggagtttcgcaggctggaagtcaattgttagatcccttgaaagta
gcttataaaaaatatgctttacgaagaacatttgcagcaacaagcttcgatttggcaaag
ttaggtaatgatgccggagtaatcggagcggcatttctagttaaaacgaatcaataa

DBGET integrated database retrieval system