KEGG   Halobacillus halophilus: HBHAL_3707Help
Entry
HBHAL_3707        CDS       T02031                                 

Definition
(GenBank) two-component response regulator
  KO
K07691  two-component system, NarL family, competent response regulator ComA
Organism
hhd  Halobacillus halophilus
Pathway
hhd02020  Two-component system
hhd02024  Quorum sensing
Module
hhd_M00476  ComP-ComA (competence) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HBHAL_3707
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    HBHAL_3707
Two-component system [BR:hhd02022]
 NarL family
  ComP-ComA [MD:M00476]
   HBHAL_3707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE HTH_23 Sigma70_r4_2 Sigma70_ECF HTH_28 HTH_38
Motif
Other DBs
NCBI-ProteinID: CCG46052
UniProt: I0JPI2
Position
complement(2667522..2668172)
Genome map
AA seq 216 aa AA seqDB search
MTRVLIVDDHPAVGAGTKAMLEQESDMKVDVIDHWDKVEDLLEQYLYDILLLDLYMPGMN
GIELAKQIRKHYPDLTLLIYTGFDLSTHFNMLVEANINGFVSKTAASEQLVTAIRCALRD
EVVIPLHLFKQLRRSEASVSQTNESQEGSGLSLNEKEQSILKEVASGFTNREIAQALHMS
QRSVEYTLTGIFNKLNVRSRTEALFKAQELGLVSKS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgactagagtattaattgtagatgatcaccctgcagttggagcaggaactaaagctatg
ctggagcaagaaagtgatatgaaggtagatgttattgatcattgggataaagtagaggac
cttctcgagcagtacttgtacgacattttgttacttgatttatatatgccagggatgaat
ggaattgaacttgccaagcaaatacgtaaacactatccggatctcaccttattaatttat
acagggtttgatcttagtactcactttaatatgcttgtggaagcaaatattaatggtttc
gtaagtaaaacagctgcgagtgaacaacttgttactgctattcgttgtgcacttagggat
gaagtggttattccgctccacctctttaaacagttaaggcgttctgaggcaagtgtcagc
caaacgaatgaatcgcaggaaggttcagggctttctttaaatgaaaaggaacagtcgatt
ctcaaggaggtagcttcagggtttaccaaccgagaaattgctcaagcgcttcatatgtct
caaaggagcgtagaatacacacttactggtatttttaataaacttaatgtacgatcaaga
acagaagctctcttcaaagcccaggaactcgggcttgtgtctaaatcataa

DBGET integrated database retrieval system