KEGG   Halobacillus halophilus: HBHAL_4069Help
Entry
HBHAL_4069        CDS       T02031                                 

Gene name
gtaB1
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00040  Pentose and glucuronate interconversions
hhd00052  Galactose metabolism
hhd00500  Starch and sucrose metabolism
hhd00520  Amino sugar and nucleotide sugar metabolism
hhd01100  Metabolic pathways
hhd01130  Biosynthesis of antibiotics
Module
hhd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HBHAL_4069 (gtaB1)
   00052 Galactose metabolism
    HBHAL_4069 (gtaB1)
   00500 Starch and sucrose metabolism
    HBHAL_4069 (gtaB1)
   00520 Amino sugar and nucleotide sugar metabolism
    HBHAL_4069 (gtaB1)
Enzymes [BR:hhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HBHAL_4069 (gtaB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD Smr
Motif
Other DBs
NCBI-ProteinID: CCG46410
UniProt: I0JQJ0
Position
complement(3024606..3025490)
Genome map
AA seq 294 aa AA seqDB search
MKVKKAIIPAAGLGTRFLPATKAMPKEMLPVVDKPTIQYIVEEAIESGIEDIIIVTGKGK
RAIEDHFDHAFELEENLYKKGKIDLLEKVKQSAHVDIHYIRQKEPKGLGHAIWCARKFIG
DDPFAVLLGDDIVRSDEPCLKQLMDQFEETHSSVIGVKKVPHDETNRYGIIAPKNQEGRR
YQVEHFVEKPSIEEAPSDLAIIGRYVFTPEIMDMLETQDIGAGGEIQLTDAIERLNMEQP
VYGYEFKGDRYDVGDQLGFIKTTLAVAMEREDMRDDVYELVESIVKQQKSIHGK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtgaaaaaagcaattattcctgcagcaggtcttgggacaaggttcctgcctgca
acgaaagcgatgcctaaagaaatgcttcctgttgtagataagccgacaattcagtacatt
gtggaagaagcgattgagtcaggtattgaagatattattatcgtcacagggaaaggcaaa
cgagccattgaggatcactttgaccatgcatttgagcttgaagaaaacttatataaaaaa
ggcaagattgatctgcttgaaaaggtgaaacagtctgcgcatgtggatattcactatatt
cgtcaaaaagaacctaaaggactaggacatgccatctggtgtgcgcgtaagtttataggt
gacgacccctttgccgttcttcttggcgacgacatcgtccgctcggatgaaccttgtttg
aagcaattaatggatcaatttgaagaaacccactcttctgttattggcgtgaaaaaagta
ccgcacgatgagacaaatcgatatggaatcatcgcgccaaagaaccaggagggtcgccgc
taccaggtggaacactttgtggagaagccttccatcgaagaagctccttctgatcttgct
attatcggacgttatgtattcactccagagattatggacatgcttgagacacaggatata
ggagcaggcggggagattcagctgaccgatgccatcgagcgtctgaatatggaacagcct
gtgtatggttatgaatttaaaggcgatcgttacgacgttggtgatcagcttgggtttatt
aagacgactcttgctgtagcaatggagcgcgaagacatgcgtgatgacgtttacgaattg
gtcgaaagtatcgttaaacagcaaaaatccattcacggaaaatga

DBGET integrated database retrieval system