KEGG   Halobacillus halophilus: HBHAL_4642Help
Entry
HBHAL_4642        CDS       T02031                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00071  Fatty acid degradation
hhd00072  Synthesis and degradation of ketone bodies
hhd00280  Valine, leucine and isoleucine degradation
hhd00362  Benzoate degradation
hhd00380  Tryptophan metabolism
hhd00640  Propanoate metabolism
hhd00650  Butanoate metabolism
hhd00900  Terpenoid backbone biosynthesis
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
hhd01130  Biosynthesis of antibiotics
hhd01200  Carbon metabolism
hhd01212  Fatty acid metabolism
hhd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hhd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HBHAL_4642
   00630 Glyoxylate and dicarboxylate metabolism
    HBHAL_4642
   00640 Propanoate metabolism
    HBHAL_4642
   00650 Butanoate metabolism
    HBHAL_4642
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HBHAL_4642
   00072 Synthesis and degradation of ketone bodies
    HBHAL_4642
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HBHAL_4642
   00310 Lysine degradation
    HBHAL_4642
   00380 Tryptophan metabolism
    HBHAL_4642
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HBHAL_4642
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HBHAL_4642
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HBHAL_4642
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hhd04147]
    HBHAL_4642
Enzymes [BR:hhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HBHAL_4642
Exosome [BR:hhd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HBHAL_4642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: CCG46980
UniProt: I0JS59
Position
complement(3573109..3574296)
Genome map
AA seq 395 aa AA seqDB search
MRKTVIVSGARTPFGKFGGALAPLTASQLGGIVIKEALKRAGYKGEEVDEVIMGSVLQGG
QGQLPSRQAAREAGIPWHVKTETVNKVCASGMRSVTMADQFIRLGEEDVIVAGGMESMSN
APYFMPKARWGLRMGDAPVKDMMVHDGLTCSFENVHMGNYGNRTAEEFELTREAQDEWSY
NSHQRAAQAIENGTMGEEIVSVEVPQRKGDPVVVDTDEAPRKNTTVEALSKLRPVFDKNG
TITAGNAPGVNDGACAMLLMSDEKANELGLESLATVLAHDEIAVEAQDFPQTPGLVINKL
LKKAGKSIEDIDLFEVNEAFAAVSLASGKIAGLDPEKVNVNGGAVALGHPIGASGARILL
TLAYELKRRGGGLGIAAICSGGGQGDAVLIEVPKV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaacagtaatcgtgtcaggggctcgtactccatttggaaaattcgggggcgct
cttgctcctttaacagcttcccagcttggaggcatcgtgattaaagaggctttaaagcgt
gctggatacaagggtgaagaagtagatgaagtaatcatggggagcgttttacagggagga
cagggacagctgccatcccgccaggccgcgcgtgaagctggaattccgtggcacgtgaaa
acagagacagtcaacaaggtgtgcgcttctggaatgcggagtgtaacgatggctgatcag
ttcatccgtttaggcgaggaggatgtcatcgtagcgggcggaatggaaagcatgagcaat
gctccttatttcatgccaaaagcacgctggggattacgcatgggagacgctccggttaaa
gatatgatggtacacgatggtcttacctgttcatttgaaaatgtacacatgggtaactac
ggaaaccgtacagctgaagaattcgagttaacacgtgaagcgcaggacgagtggtcgtat
aacagccatcagcgcgcagcccaggctattgaaaacggaacgatgggtgaagaaatcgtg
tctgtagaagttcctcagcgaaaaggggacccggttgtcgtcgacacagatgaagcacca
agaaaaaatacaactgtagaagctctttctaaactgcgcccagtgttcgacaaaaatgga
acgattacggctggtaatgcgccgggtgtcaacgacggagcatgcgcgatgctgctcatg
tctgatgaaaaagcaaacgaattagggctcgaatccctggcaaccgtccttgctcatgat
gaaattgccgtggaggctcaagacttccctcaaaccccggggctggtcattaataaacta
ttgaaaaaagcaggaaaatccatagaagatattgatttatttgaagtgaatgaagcattt
gcagccgtgtccttagccagtggaaaaattgccggtcttgatccggagaaagtaaatgta
aacggaggagctgtagcccttggacacccgattggggcaagcggggcgagaatcttactt
acacttgcttatgaattgaagcgccgcggaggcggtcttggaattgcagctatttgttcc
ggtggcggacagggcgatgccgtattaatcgaagtaccaaaggtataa

DBGET integrated database retrieval system