KEGG   Helicobacter hepaticus: HH_0667Help
Entry
HH_0667           CDS       T00133                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hhe  Helicobacter hepaticus
Pathway
hhe00051  Fructose and mannose metabolism
hhe01100  Metabolic pathways
hhe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HH_0667
Enzymes [BR:hhe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HH_0667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AAP77264
UniProt: Q7VID9
Position
645722..646345
Genome map
AA seq 207 aa AA seqDB search
MNIHTTQVSPELIASIASISLSMFRKNFFGVFHGAISARVAKNRFIINKQQAIFDNLNAN
SMIALYHRQDYRWDEASLHAPIHASIYEHFSEAKFIAYAMPPYLVSYSLKYNALKPQDYF
GYKFLAPCIEIFDPKDYETWEKRADTDIPRYFKEHNHSFMLIKGYGVYAYARDIYTLAKV
IALIENSCKILHYNASLHERCQDKSQI
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacataccactcaagttagcccagaacttattgcaagtattgctagtatttcg
ctttctatgtttagaaagaatttctttggtgtatttcacggagcaatttctgcgcgtgtg
gcaaaaaatcgctttattatcaacaaacaacaagctatttttgataacctcaatgcgaat
tctatgattgcactttatcatagacaagattatcgctgggacgaagctagcttacacgct
cctatacacgcaagtatttatgagcatttctctgaagcaaaattcattgcttatgctatg
ccaccctatcttgtttcctactctctcaaatataatgcccttaaacctcaagattatttt
ggctacaaatttctcgccccctgcattgaaatttttgaccccaaagattatgaaacttgg
gaaaaacgagcagatactgatattccacgatattttaaagaacacaatcattcttttatg
ttaattaaaggctatggtgtatatgcctatgctcgtgacatttacacacttgctaaagta
attgctcttattgaaaattcgtgtaaaatcttacattataatgcaagtttgcacgaaaga
tgtcaagataaatcccaaatataa

DBGET integrated database retrieval system