KEGG   Helicobacter hepaticus: HH_0977Help
Entry
HH_0977           CDS       T00133                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
hhe  Helicobacter hepaticus
Pathway
hhe00220  Arginine biosynthesis
hhe01100  Metabolic pathways
hhe01110  Biosynthesis of secondary metabolites
hhe01130  Biosynthesis of antibiotics
hhe01230  Biosynthesis of amino acids
Module
hhe_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:hhe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    HH_0977 (argF)
Enzymes [BR:hhe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     HH_0977 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AAP77574
UniProt: Q7VHJ0
Position
complement(948388..949377)
Genome map
AA seq 329 aa AA seqDB search
MKHFLTLNDFNRDEILAMVDVALELKYESLHIGNKPYLKGKVLAMIFEKSSTRTRVSFES
GIFQLGGQGIFLSHKDIQLGRGEPIKDTARVISSMVDMIMMRTSEHSRLEEFASYSSVPV
INGLSDDFHPVQLIADYLTMIECGIYLTHHNPLYPTKGKGGRNPIVAYIGDGNNMAHSWI
NLAGILGFELRIASPIGYAPKADIITKAQDMCIQSGGKIKILNDAKEAVSNANVVVTDTW
ASMGQEEQKEQRKCAFANFCVDEAMMSYAQKDAIFLHCLPAYRGQEVSEGVLEGAQSKVF
QEAQNRLHAQKGIMLYLARINKIPLVSVE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttctcactctgaatgattttaacagagatgaaattctagcaatggttgat
gttgccctagaacttaaatacgaatctttgcatattggtaacaaaccttatcttaagggt
aaagttttggcgatgatttttgaaaaaagctctacgcggacacgagtaagctttgagagt
ggtatatttcaattaggcggacagggtatattcctttctcataaagatatacaacttgga
cgaggcgaacccatcaaagacaccgcacgagtgattagttcgatggtagatatgataatg
atgagaacaagtgagcatagcagattagaggagttcgcctcatattcatctgtgcctgtg
attaatggattgagtgatgattttcaccccgtgcagcttatcgcggattatcttacgatg
atagaatgcggtatttatcttactcatcacaatcctctttatcccacgaaaggcaaggga
gggaggaatcctattgtagcatatattggtgatggcaataatatggcacattcgtggatt
aaccttgctggtattttgggctttgaattgcgtattgcttcaccaattggatatgcacct
aaggcagatattatcacaaaggcacaggatatgtgtatccaaagtggaggtaaaatcaag
attctaaatgacgcaaaagaggcagtgagtaatgcaaatgttgtggttaccgatacttgg
gcgtcaatgggacaagaagaacaaaaagaacaacgcaaatgtgcttttgcaaatttttgt
gtagatgaggctatgatgagctatgcacaaaaagatgctatttttttgcattgtctccct
gcatatagagggcaagaggtgagtgaaggtgtgcttgagggcgcacagagcaaagtattc
caagaagcacagaatcgccttcacgcgcaaaagggcattatgctctatttagcacggata
aataaaatcccgcttgtgagcgtggagtaa

DBGET integrated database retrieval system