KEGG   Helicobacter hepaticus: HH_1310Help
Entry
HH_1310           CDS       T00133                                 

Definition
(GenBank) methyl-accepting chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
hhe  Helicobacter hepaticus
Pathway
hhe02020  Two-component system
hhe02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hhe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HH_1310
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    HH_1310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:hhe02035]
    HH_1310
Bacterial motility proteins [BR:hhe02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    HH_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NIT MCPsignal DUF948 POTRA_TamA_1 HAMP
Motif
Other DBs
NCBI-ProteinID: AAP77907
UniProt: Q7VGL1
Position
complement(1268185..1270191)
Genome map
AA seq 668 aa AA seqDB search
MTSALRHLSIKIQILALVAIPIIALIYFLFIQFSYTLDSISQAQNLQKQIHISEQLSRLV
HEMQKERGMSAGFLASSGTKFANELKGQRLLTDKEHKALSDMLSQSSNLPQSYLTQLHQG
LESVAKIQQIRNDADKSIEDKINIAPQVIGYYTSTIAFLLDSVLESTKIIYDAQLAKSMV
AYTSFLYAKERAGLERATINGIFTHNGVPNDNNYNKVVSLIAEQDAYIKFFLSIASQESI
DFYKNAIKNPSFEQVQQMREILHSKRHSGNFGIEPKVWFDTITTKINVLKEVEDFIAHRL
DSFITQHIQTLQNEFIKWLILEGVIMIFTLFLCFIVVKNILTRLNNVNTKLAYITQNKDL
REQIKVLANDEISAMAHSVNAFIRYIHNVFLEVIKQTKNNLSITQILIDVSHKLDSNTKD
IAKISENNTGLGEKSYSIIEQNITLSQATKETLESVLLDVNQTKHIIESINEEIGQFTIK
ENQNVEKILSLANEAKNIQSVLIAITDIADQTNLLALNAAIEAARAGEHGRGFAVVADEV
RKLAERTQKSITETSSIIQSILQSINEISSDMEQSSQSMNHLTQQSEIMHNNIESLSNIV
QEAMEKSLLNLEGAQKVNANTSEILDNGIKIASCVAQIVEINEKMQKSSGTLGTQTKTLN
EMIDTFKI
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgcacttcgccatttaagcatcaagattcaaattcttgcacttgtagcaatt
cccattattgcacttatatattttctctttattcagttttcttatacgcttgattctatc
tctcaagcacaaaacctacaaaaacaaattcacatctccgaacagctctcaagacttgtg
cacgaaatgcaaaaagaacgaggtatgagtgctggatttctcgcaagtagtggcacaaaa
tttgcaaatgagcttaaagggcagaggctactcacagataaagaacataaagctctaagc
gatatgctctctcaaagcagcaatttaccccaaagctaccttacacaacttcatcaaggt
ttagaatctgtggcaaaaatacagcagattcgcaatgatgcagataaatctattgaagat
aaaatcaatatagcgccacaagttattggctattatacttctacgatagcttttttactt
gatagtgttttagaatctacaaaaatcatttatgatgcacaacttgctaagtctatggtc
gcttatacaagctttttatatgcaaaagaacgtgcaggactagaacgcgctactattaat
ggtatctttacccacaatggtgtgccaaatgataataattataataaagttgtctctttg
attgccgaacaagatgcgtatataaaattctttctctcaattgcctcacaagagagcatt
gatttttacaaaaatgcaattaaaaatccaagctttgaacaagtccaacaaatgcgtgag
attctgcattctaaacgtcatagtggaaattttgggattgaaccaaaagtatggtttgat
accattacaacaaaaattaatgtgcttaaagaagtggaagattttatcgcccatcggctt
gatagctttatcactcaacatattcaaacattacaaaacgagtttattaaatggcttata
cttgagggtgttattatgatatttacactctttttatgctttattgtggtaaaaaacatt
ctcacacgacttaacaatgtcaataccaaacttgcttatattacacaaaataaagattta
agagagcaaattaaagtattagccaatgatgaaatttctgctatggcacattctgtaaat
gcttttatccgctatattcacaatgtatttttagaagtaattaaacaaacaaaaaataat
ctctctattacacaaatacttatagatgtttcccacaaacttgatagcaacaccaaagac
attgctaagatttctgaaaataacacaggacttggagaaaaaagctactctatcatagag
caaaatattacactctctcaagcaacaaaggaaacattagaatctgtgcttttagatgtt
aatcaaacaaaacatatcatagaatctattaatgaggagattgggcaatttacaataaaa
gaaaatcaaaatgtagaaaaaatactctcccttgctaatgaagcaaaaaatattcaaagt
gtgcttatagcaattaccgatatagcagatcaaacaaacttacttgctcttaatgcagca
atagaagctgcacgtgcaggagaacacggaagaggatttgctgttgttgcagatgaagta
agaaaactagctgagagaactcaaaaatccattacagaaacaagtagcattattcaatcc
atattgcaatctatcaatgagatttcctctgatatggagcaaagctctcaatctatgaat
catctcacacaacaatccgaaataatgcataacaatatagaatccctctcaaatatcgtg
caagaagcaatggaaaaatcacttcttaacttagagggtgcgcaaaaagtcaatgctaat
acatcagaaattttagataatggcattaagattgcctcttgtgtagcacaaattgtagag
attaatgaaaaaatgcaaaaaagttcaggcacacttggcacacaaacaaaaacacttaat
gagatgattgatacttttaaaatataa

DBGET integrated database retrieval system