KEGG   Helicobacter hepaticus: HH_1383Help
Entry
HH_1383           CDS       T00133                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hhe  Helicobacter hepaticus
Pathway
hhe03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hhe00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HH_1383 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hhe03011]
    HH_1383 (rplV)
Ribosome [BR:hhe03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HH_1383 (rplV)
  Bacteria
    HH_1383 (rplV)
  Archaea
    HH_1383 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AAP77980
UniProt: Q7VGD9
Position
1332707..1333279
Genome map
AA seq 190 aa AA seqDB search
MSRALLKYIRLSPTKARLVARQVQGMNAEIAIASLEFTPNKAARVISKVIASAVANGGYD
AQDVIILSCRVDAGPVLRRFMPRAKGRATPIRKPMAHILVEVGTQKSVQQSVQSTKAKAK
GAKNIKSEDSKNSLKVTESKADSKVDAAQKASTTQEKAESKTKVAKAKVATTKSTATRKT
TKKKTEGEEK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagcattattaaaatatatccgattatctccaacaaaagcgcgtttagtggct
cgccaagtgcagggtatgaatgcagagattgctattgcgagtttggaatttactcccaat
aaagctgcacgagtgatttcaaaggttattgcatctgctgttgcaaatggtggatatgat
gcccaagatgttatcattctttcttgtcgtgttgatgcgggtcctgtattgcggcggttt
atgccacgagctaaaggacgagcaacacctattcgtaagccaatggcacatattttagta
gaagttggaacgcaaaaatctgttcaacaatctgttcaatcaacaaaagctaaggcaaaa
ggagcaaaaaatattaagagtgaagattctaaaaattctttaaaagttacagaatctaaa
gcagattcaaaagtagatgccgcccaaaaggcatcaacaacgcaagaaaaagctgaatct
aaaactaaagtagctaaagcaaaagtggcaacaacaaaatcgacagcaacaagaaaaaca
acaaagaaaaaaactgaaggcgaggaaaaataa

DBGET integrated database retrieval system