KEGG   Helicobacter hepaticus: HH_1461
Entry
HH_1461           CDS       T00133                                 

Definition
(GenBank) hypothetical protein
  KO
K01607  4-carboxymuconolactone decarboxylase [EC:4.1.1.44]
Organism
hhe  Helicobacter hepaticus
Pathway
hhe01100  Metabolic pathways
hhe01120  Microbial metabolism in diverse environments
hhe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hhe00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HH_1461
Enzymes [BR:hhe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     HH_1461
SSDB
Motif
Pfam: CMD FumaraseC_C
Other DBs
NCBI-ProteinID: AAP78058
UniProt: Q7VG63
Position
1404325..1405242
AA seq 305 aa
MQEYKELLERREFLKTSAKFGAVASLVSLSGFALSACDSKTSNTQTQHIQGDTMKTNLTP
KAKQTFEKLFGSTDVPLSKSDPEFFSNYVNFAFDEVPSESKLELKEGLMITLASLVAIPA
LSEFKAILNAALKNGVEPVAIKEILYQATPYVGMGKVLDFINATNEIFAQLGIALPLESQ
GRVEYAQRREKGLETQRALFGEAIDKGNAAAPKDYQHIRTFLSANCFGDYYTRGGLPLKF
RELLTFVYILSMGGADSQVRAHIAGNIRVGNDRGKLISVITALVPYIGYPRSLNALSALD
EIAPL
NT seq 918 nt   +upstreamnt  +downstreamnt
atgcaagagtacaaagagttattagagcgcagggagtttctcaaaacctctgcaaagttt
ggcgcagttgcaagtctagtgagccttagcggatttgccttaagtgcgtgtgattctaag
acttcaaacacgcaaacacaacacattcaaggagacacaatgaaaactaatctaacccca
aaagccaagcaaacctttgaaaagctttttggcagcaccgatgtgccactaagcaaaagc
gaccccgagttttttagtaattatgtgaattttgcctttgatgaggtgccaagtgaatcc
aagcttgagctaaaagaaggcttgatgattactcttgcctcacttgtagctattcctgct
ttgagtgagtttaaggcaattctcaacgcagctttgaaaaatggcgttgaacctgtggca
attaaggaaattctctaccaagccacgccttatgtgggtatggggaaagtgctagatttt
attaatgccaccaatgaaatctttgcacaacttggaattgcgcttcctttggaatctcaa
ggcagggtagaatacgctcaaaggagagaaaaagggctagaaacccaacgcgcacttttt
ggtgaggcgattgacaaaggcaatgccgcagcaccaaaggattatcaacatatccgcacc
tttttaagtgcgaattgctttggggattattacacgcgcggtgggcttcctctaaagttt
agggagcttttaacctttgtgtatatcctctcaatgggcggggcagattctcaagtgagg
gcgcatatcgcaggaaatataagagtgggaaatgatagaggcaaactcatctctgtcatc
accgcacttgtgccttacatcggctaccctagaagcttaaacgccctaagtgcgcttgat
gagattgcgccgttgtag

DBGET integrated database retrieval system