KEGG   Herbaspirillum huttiense: E2K99_01770Help
Entry
E2K99_01770       CDS       T05937                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
hhf  Herbaspirillum huttiense
Pathway
hhf00471  D-Glutamine and D-glutamate metabolism
hhf00550  Peptidoglycan biosynthesis
hhf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    E2K99_01770 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    E2K99_01770 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hhf01011]
    E2K99_01770 (murD)
Enzymes [BR:hhf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     E2K99_01770 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:hhf01011]
 Precursor biosynthesis
  Amino acid ligase
   E2K99_01770 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_7 Acyl-CoA_dh_1 Menin
Motif
Other DBs
NCBI-ProteinID: QBP73815
UniProt: A0A4P7A476
Position
391847..394009
Genome map
AA seq 720 aa AA seqDB search
MNYSGKHVLVLGLGESGLAMARWLVYCGAGVRVADTRGEAALAERLAALRAGAPEAQAVL
GQPLSPSLLDGIDFVAVSPGLAPEGELAPLMPAIAERGLPLWGEIELFAQALAALREETL
YQPKVLAITGTNGKTTVTRLTGLLCQRAGLSVQVAGNISPAALDVLREAVIKDKVFLAEL
AEQDAIAAEQAAAEAEAQAAQQAVLDAQQAAEAEKHRRAAASIEAAAAIAVPVLQAQPQA
DAPVSASESEPAPQMDLLATAEEQPVAEQEAGQENVQESVPETGQETGQETAQETAQQPA
PETGHPATEASPDDAEAASSAAHEAPEPAVAATLDVASDAIPQAEIDAPATTGEAMNLGD
FMEVSRKAEEDALVEVPPPPPPEPTYRGSMPQAWVLELSSFQLHTTHSLQPHAATVLNLT
QDHLDWHGSMEHYAADKARIFGQDTVRVLNRDDALVMEMSAAAAPLSTFGLDEPSTPNSF
GLVNDNGMLWLANAFVHEDDEVPEGKRRRKQKDMLPPPVTVKRLMPADALRIRGAHNAMN
ALAALALCRAIDLPMAPLLHGLREYTGEPHRVELVGVIQDVEYYDDSKGTNVGATVAALN
GLGLGGRPNRIVLIAGGDGKGQDFSPLDLPVQKYARAVLLIGRDGPAVRAALADSGVELI
DCASLEAAVEKAGELATAGDIVLLSPACASLDMFRNYAHRAEVFVDAVRELALSRGEVLT
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaattactcgggcaaacacgttctggtgctcggactcggcgagtccggcctggcaatg
gcgcggtggctggtctactgcggcgccggcgtgcgcgtggccgatacccgtggcgaagcg
gccctggccgagcgtctggccgccttgcgcgccggcgcgcccgaggcgcaggccgtgctg
ggccagcccttgtctccgtccttgcttgatggaatcgatttcgtcgccgtcagtcccggc
ctggcacccgaaggcgagctggcaccgctgatgccggccattgccgaacgcggcctgccg
ctgtggggcgagatcgaattgtttgcgcaggcgctggccgccttgcgcgaagagaccctg
tatcaacccaaggtgctggccatcaccggcaccaacggcaagactaccgtgacccgcctg
accggcctgctgtgccagcgcgccggcctgtcggtgcaagtggcgggcaacatcagcccg
gccgccctggatgtgctgcgcgaagcggtcatcaaggacaaggtattcctggccgaactg
gccgagcaggatgcgatcgccgccgaacaggctgccgccgaagctgaagcgcaagccgcg
cagcaggccgtgctggatgcccagcaggcggccgaagccgagaagcatcgccgtgccgcc
gccagcatcgaggcggccgcagcgattgcggtgccagtgttgcaggcgcagccgcaagca
gacgcgccggtctccgcatcggaatctgaacccgcgccgcagatggatctgctggcgact
gcggaagagcagccggtggcagagcaggaagctggacaggagaacgtacaggaatctgta
ccggaaacagggcaggaaacaggacaggaaactgcacaggaaactgcacagcagccggca
cccgagaccgggcatccagccaccgaagcctcccccgatgacgccgaggcagccagctct
gccgcgcacgaagcgccggagccggctgtcgcggccacgctggacgtcgcttccgacgcg
atcccgcaagccgagatcgacgccccggcgaccactggcgaggccatgaacctgggcgat
ttcatggaggtctcgcgcaaggccgaggaagatgcgctggtggaagtcccgccaccgccg
ccgcccgagccgacctatcgcggctcaatgccgcaagcctgggtgctggagctttccagc
ttccagctgcacaccacgcacagtctgcagccgcacgccgccaccgtcctgaatttgacc
caggatcacctggactggcacggcagcatggagcactacgccgccgacaaggcccgcatc
ttcggccaggataccgtgcgcgtactcaatcgcgatgacgccctggtgatggagatgagc
gccgccgccgcgccgctgtccaccttcggcctggacgaaccgtccacgcccaacagcttc
ggcctggtcaacgacaacggcatgctgtggctggccaatgccttcgtgcatgaagatgac
gaagtgccggagggcaagcgccgccgcaagcagaaggacatgctgccgccgccggtgacc
gtcaagcgcctcatgcccgccgatgccctgcgcattcgcggtgcccacaacgccatgaat
gcgctggccgcactggccttgtgccgcgccatcgacctgccgatggctccgctgctgcac
ggcctgcgcgagtacaccggcgagccgcatcgcgtggaactggtcggcgtgatccaggat
gtcgagtactacgacgacagcaagggcaccaatgtcggtgccaccgtggccgcgctcaat
ggcttggggctgggcggccgtcccaatcgcatcgtgctgatcgccggtggcgacggcaag
ggccaggacttttcgccgctggacctgccggtacagaaatatgctcgtgcagtcttgctg
atcggccgcgatggccctgccgtgcgcgccgccctggccgacagcggggtcgagctgatc
gattgcgccagcctggaagccgccgtggaaaaggccggagaactcgccaccgctggcgac
atcgtgctgctctcgccggcttgcgccagcctggacatgttccgcaactacgcccatcgc
gccgaagtcttcgtggatgcggtgcgtgaactggcgctctcgcgcggtgaggtgctgaca
tga

DBGET integrated database retrieval system