KEGG   Herbaspirillum huttiense: E2K99_11820Help
Entry
E2K99_11820       CDS       T05937                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hhf  Herbaspirillum huttiense
Pathway
hhf00010  Glycolysis / Gluconeogenesis
hhf00053  Ascorbate and aldarate metabolism
hhf00071  Fatty acid degradation
hhf00280  Valine, leucine and isoleucine degradation
hhf00310  Lysine degradation
hhf00330  Arginine and proline metabolism
hhf00340  Histidine metabolism
hhf00380  Tryptophan metabolism
hhf00410  beta-Alanine metabolism
hhf00561  Glycerolipid metabolism
hhf00620  Pyruvate metabolism
hhf00625  Chloroalkane and chloroalkene degradation
hhf00903  Limonene and pinene degradation
hhf01100  Metabolic pathways
hhf01110  Biosynthesis of secondary metabolites
hhf01120  Microbial metabolism in diverse environments
hhf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hhf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E2K99_11820
   00053 Ascorbate and aldarate metabolism
    E2K99_11820
   00620 Pyruvate metabolism
    E2K99_11820
  09103 Lipid metabolism
   00071 Fatty acid degradation
    E2K99_11820
   00561 Glycerolipid metabolism
    E2K99_11820
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    E2K99_11820
   00310 Lysine degradation
    E2K99_11820
   00330 Arginine and proline metabolism
    E2K99_11820
   00340 Histidine metabolism
    E2K99_11820
   00380 Tryptophan metabolism
    E2K99_11820
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    E2K99_11820
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    E2K99_11820
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    E2K99_11820
Enzymes [BR:hhf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     E2K99_11820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF3813 DUF742
Motif
Other DBs
NCBI-ProteinID: QBP75665
UniProt: A0A4P7A8S6
Position
complement(2607252..2608685)
Genome map
AA seq 477 aa AA seqDB search
MKQHFIDNRWVAPASGESIPVIDPSDGQAFEAIARGNAADIDQAVQAARRAYEGAWGKLS
AAERSRLLMKLAHKLQDHQEELAQLEGRDCGKPMKQARADAAAIVRYFEFYAGAADKLHG
DTIPYQAGYTVLTLREPHGVTGHIVPWNYPMQIFGRCVGGALAAGNTCVVKPAEDACLSI
LRVAELAAEAGFPEGALNIVTGYGHEAGDLLVKHPDVNHVSFTGSPNVGKLVVRAAAEHH
TPVTLELGGKSPQVVFEDADMDALLPVVVNAIVQNAGQTCSAGSRLLVQRGAYEQVLERL
AGLFSQLKVGSSQMDLDCGPLIRKTQQERVAGFLSDARRDGIALVAQGEIAPGAPSGGFY
QAPALLRDVPPQHRLAQEEVFGPVLAAMSFEDEAEAIALANGTDYGLVASVWTRDGGRQL
RLARAIRSGQVFINNYGAGGGVELPFGGVKASGHGREKGFEALYGFTVLKTIAIRHG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcacttcatcgacaatcgctgggtcgcccccgcctccggcgaaagcatcccc
gtcatcgatccctccgatggccaggccttcgaggccatcgcccgtggcaatgccgccgac
attgaccaggccgtgcaggcagcacgccgcgcgtatgaaggtgcgtggggcaagctttcc
gccgccgagcgcagccgcctgctgatgaagctggcccacaagctgcaggatcaccaggaa
gaactggctcagctggaaggacgcgactgcggcaaacccatgaaacaggcacgtgccgat
gctgcggccatcgtgcgctacttcgagttctacgccggtgccgctgacaagctgcacggc
gacaccattccctaccaggccggctatacggtactgaccctgcgcgagccgcacggcgtg
accggccacatcgtgccgtggaactacccgatgcagatcttcggacgctgcgtgggcggc
gctctggccgctggcaatacctgcgtggtcaagccggccgaggatgcctgcctgtccatc
ctccgggtagccgaactggccgctgaggcgggcttccccgagggtgcactcaacatcgtc
accggctatggccacgaggccggcgacctgctggtcaagcatcccgatgtgaaccacgtg
tccttcaccggctcacccaacgtgggcaagctggtggtgcgcgcggccgccgagcatcac
accccggtcaccctggaactgggcggcaagtcgccgcaggtggtcttcgaggatgccgac
atggacgccctgctgccggtggtggtcaatgccatcgtgcagaacgccggccagacctgc
tccgccggcagccgcctgctggtccagcgtggcgcttacgaacaggtgctggagcggctt
gccgggctgttttcgcagctcaaggtgggctcctcgcagatggacctggactgtggtccg
ctgatccgcaagacccagcaggaacgcgtggccggtttcctctcggatgcacggcgcgac
ggcatcgccctggtggcgcaaggcgagatcgcgcccggcgccccgtccggcggtttctac
caggccccggccctgctgcgcgacgtgccgccccagcatcggctggcgcaggaagaagtg
ttcggtccggtactggcggccatgtcgttcgaggatgaagccgaggccatcgccctggcc
aatggcaccgactacggcctggtggccagcgtctggacccgcgacggcggccgccagctg
cggctggcgcgcgccattcgcagcggccaggtcttcatcaacaactatggcgccggtggc
ggcgtggaactgcccttcggcggcgtcaaggccagcggccacgggcgcgagaagggcttc
gaagccctttatggcttcacggtcctcaagaccatcgccatccgccacggctga

DBGET integrated database retrieval system