KEGG   Herbaspirillum huttiense: E2K99_11985Help
Entry
E2K99_11985       CDS       T05937                                 

Gene name
acnD
Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
hhf  Herbaspirillum huttiense
Pathway
hhf00640  Propanoate metabolism
hhf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    E2K99_11985 (acnD)
Enzymes [BR:hhf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     E2K99_11985 (acnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: QBP75692
UniProt: A0A4P7A7V7
Position
complement(2645052..2647673)
Genome map
AA seq 873 aa AA seqDB search
MNTQYRKQLPGTRLDYFDARAAVEAIHPGAWETLPYTSRVLAENLVRRCDPATLTDSLRQ
LIERKRELDFPWFPARVVCHDILGQTALVDLAGLRDAIADMGGDPAKVNPVVPVQLIVDH
SLAVECGGDDPQAFEKNRAIEDRRNEDRFHFIDWTKLAFENVDVIPPGNGIMHQINLEKM
SPVIHAKDGVAFPDTLVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRLPDIIGV
ELTGRRQPGITATDIVLSLTEFLRKQKVVGAYLEFYGDGAASLTLGDRATISNMAPEYGA
TAAMFSIDQQTIDYLKLTGREDEQVKLVETYAKEAGLWSDSLSKAEYERVLRFDLSTVVR
TLAGPSNPHKRLPVSELAAQGIAGKVENEPGKMPDGAVIIAAITSCTNTSNPRNVIAAAL
LARNANRLGLARKPWVKSSLAPGSKAVELYLEEAGLTADLEKLGFGIVAFACTTCNGMSG
ALDPKIQQEIIDRDLYSTAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIE
QDVLGVTAEGKEIRLKDIWPSDEEIDAVVATAVKPQQFRNVYTPMFSARVDRSQSVSPLY
DWRPQSTYIRRPPYWEGALAGERTLSGMRPLAVLGDNITTDHLSPSNAILLDSAAGEYLA
KMGLPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVRKADGSVQQGSLARLEPEGKVMR
MWETIETYMERKQPLIIVAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLIGM
GVLPLEFKAGENRNTYAIDGTETYDVIGQRRPRADLTLVIHRKNGERVEVPVTCRLDTAE
EVSIYEAGGVLQRFAQDFLEASANAGQNTKEQA
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccaataccgcaagcaactgcccggcacccgactggattatttcgatgcccgc
gccgccgtggaagcgatccatcctggcgcatgggaaaccctgccctacacttcccgtgtg
ctggcagaaaacctggtgcgccgctgtgatccggcgaccctgacggattcactgcgccag
ctgatcgaacgcaagcgtgaactggacttcccgtggttcccggcgcgcgtggtgtgccac
gacatcctgggccagaccgcgctggtggatctggccggcttgcgcgacgcaattgccgac
atgggcggcgacccggccaaggtcaacccggtggtaccggtgcaactgatcgtggaccac
tcgctggcggtggaatgtggcggcgacgatccgcaggccttcgaaaagaatcgcgccatc
gaagaccgccgcaatgaagaccgcttccacttcatcgactggaccaagctggcgttcgaa
aacgtggacgtgatcccgcccggcaacggcatcatgcaccagatcaatcttgagaagatg
tcgccggtgatccacgccaaggatggcgtggccttccccgacaccctggtcggcaccgac
agccataccccgcacgtggacgcgctgggcgtgatcgccatcggcgtgggtggcctcgaa
gcggaaaacgtcatgctcggccgcgcctcctggatgcgcctgcccgacatcatcggcgtg
gaactgaccggccgccgccagcccggcatcacggccaccgacatcgtgctttcgctgacc
gaattcctgcgcaagcagaaggtggtgggcgcctatctggaattctatggcgatggcgcg
gccagcctgacgctgggggaccgcgccaccatctccaacatggccccggaatacggcgcg
acagccgccatgttctccatcgatcaacagaccatcgattacctgaagctgaccggacgt
gaagatgaacaggtcaagctggtggaaacctatgccaaggaagccggcctgtggtccgat
agcctcagcaaggccgaatacgagcgcgtgctgcgcttcgacctctccaccgtggtccga
accctggccggtcccagcaatccgcacaagcggctgccggtgtccgagctggccgcccaa
ggcatcgccggcaaggtggagaacgagccgggcaagatgcctgatggcgccgtcatcatc
gccgccatcaccagctgcaccaacaccagcaacccgcgcaacgtgatcgcagccgccctg
ctggcgcgcaatgccaatcgcctgggcctggcccgcaagccttgggtgaagagctcgctg
gcacctggctccaaggcagtggaactgtatctggaagaagcgggcctgaccgctgacctg
gaaaagctgggcttcggcatcgtcgcctttgcctgcacgacgtgcaacggcatgtccggc
gcgcttgacccgaagattcagcaggagatcatcgaccgcgacctgtacagcactgccgta
ctgtcgggcaaccgcaacttcgatggccgcatccacccgtatgccaagcaggctttcctg
gcctcgccgccgctggtggtggcctatgccattgccggcaccatccgtttcgacatcgaa
caggacgtgctgggcgtgaccgccgaagggaaggaaatccgcctcaaggacatctggccc
agcgacgaggaaatcgatgctgtggtggctaccgcagtcaagccccagcaattccgcaat
gtctacaccccgatgttctccgcacgcgtggaccgcagccaatcggtcagcccgctgtac
gactggcgtccgcaaagcacctacatccgtcgtccgccctactgggaaggtgcgctggcc
ggtgagcgcacgctctcgggcatgcggccgctggccgtgctgggcgacaacatcaccacc
gaccacctctcgccctccaacgccatcctgcttgacagtgccgccggcgaatacctggcc
aagatgggcttgccggaggaagacttcaattcctacgccacccatcgtggcgaccacctg
accgcgcagcgcgccaccttcgccaatcccaagctgttcaacgaaatggtcaggaaagcc
gatggcagcgtgcaacaaggttcactggcgcgcctggaaccggaaggcaaagtcatgcgc
atgtgggaaaccatcgaaacctacatggaacgcaagcagccgctgatcatcgttgccggg
gctgattacggccagggttcctcgcgcgactgggccgccaagggcgtgcgcctggcgggt
gtggaagccatcgtggccgaaggcttcgaacgcatccaccgtaccaacctgatcggcatg
ggcgtgctgccgctggaattcaaggccggcgaaaaccgcaatacctacgccatcgacggt
accgaaacctatgacgtcatcggccagcgccgtccgcgcgccgacctgacgctggtgatc
caccgcaagaatggcgagcgtgtggaagtgccggtgacctgccgtctcgataccgccgaa
gaagtgtcgatctacgaagccggcggcgtgctgcagcgcttcgcccaggatttcctggaa
gcctccgccaacgccggccagaacaccaaggaacaagcatga

DBGET integrated database retrieval system