KEGG   Halomicronema hongdechloris: XM38_005180Help
Entry
XM38_005180       CDS       T04928                                 

Gene name
chlL
Definition
(GenBank) Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
hhg  Halomicronema hongdechloris
Pathway
hhg00860  Porphyrin and chlorophyll metabolism
hhg01100  Metabolic pathways
hhg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XM38_005180 (chlL)
Enzymes [BR:hhg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     XM38_005180 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MipZ MeaB AAA_25 AAA_24
Motif
Other DBs
NCBI-ProteinID: ASC69591
UniProt: A0A1Z3HH21
Position
complement(519094..519963)
Genome map
AA seq 289 aa AA seqDB search
MKLSVYGKGGIGKSTTSCNISVALAKRGRKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQE
RDFHYEDIWPEDVIHRGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVIL
FDVLGDVVCGGFAAPLNYSDYCMIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGN
RTSTRDLIDKYIENVPMPVLEILPLIEDIRVSRVKGKTIFEMAETDPSLEPVCQFYLNIA
DQLLSSPEGVVPKESADRDLFSLLSDFYLNPPSDAPATQTEDELDLMMV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactctcggtctatggcaaaggtggcatcggtaagtccaccaccagctgcaacatc
tctgtggcgctagctaaacgaggacgcaaggtactgcaaattgggtgcgaccccaagcac
gacagtaccttcaccctgacgggctttttgattcccaccatcatcgataccctgcaagag
agggatttccactacgaagacatctggcccgaggatgtgatccaccgcggctatggcggt
gtcgactgcgtcgaagccggagggcctccagctggagctggctgcggtggctacgtcgtc
ggtgagacggtgaaactcctgaaggagctcaacgccttcgatgagtacgatgtcatcctc
ttcgatgtgctcggagatgtggtctgtggtgggtttgctgcccccttgaactactctgac
tactgcatgatcgtcaccgataacggcttcgatgccctgtttgccgccaatcgcatcgcc
gcctccgtgcgggaaaaagcccgcacccatccgctacggctggccgggctcatcggcaac
cgtacctccacccgggacctgatcgataaatacatcgaaaatgtgcccatgccggtattg
gagattctgcccttgatcgaagacattcgagtctcgcgggtgaagggcaagaccatcttc
gagatggctgaaaccgatccatccctggagccggtatgccagttttacctgaatatcgcc
gatcagctcctgagcagtccagaaggggtagtcccgaaggaatctgccgatcgggatctg
ttctccctgttgtcagacttctacctcaatcctcccagcgatgcccctgccacccagaca
gaagacgagctggatctgatgatggtctaa

DBGET integrated database retrieval system