KEGG   Halomicronema hongdechloris: XM38_017200Help
Entry
XM38_017200       CDS       T04928                                 

Gene name
ydgJ
Definition
(GenBank) putative oxidoreductase YdgJ
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
hhg  Halomicronema hongdechloris
Pathway
hhg00860  Porphyrin and chlorophyll metabolism
hhg01100  Metabolic pathways
hhg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XM38_017200 (ydgJ)
Enzymes [BR:hhg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     XM38_017200 (ydgJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA NAD_binding_3 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ASC70773
UniProt: A0A1Z3HKF3
Position
1821589..1822599
Genome map
AA seq 336 aa AA seqDB search
MSSPLNDTLLNQPLKVGLVGTGYAAQLRAEALRADVRSHPFLVAGHRPEKTLEFSRSHGL
TVADSWQAVVHHPDVDLVCVAHLNRDHAPVVAAALQAHKHVIVEYPLAFSPQQGQQLLAL
ARAQQRLLHVEHIELLGGLHQAMQQHLPAIGAPSYVRYSTLKPQRPAPTKWTYRPAEFGF
PLVGALSRIHRLTHLFGPITAVTCQLQYDGVISRTTPEAFTSCLCIGQFQFQSGLLAEVS
YGKGELIWQVTRRMEIYGQTGALVFEADHGTLIRPEDTQPIVVGSRRGLFKRDTQMVLDH
LSSGTPLYVTPQQSLLSLAVADAARRSAETGEMVRL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgagcccactgaatgacacactcctgaatcagcccctcaaggtaggtctggttggt
accggctatgctgctcagctacgagcagaagcgctacgggcagatgtgcgatcgcatcct
tttttagtcgcgggtcatcgtcccgagaaaaccctggaattcagtcgcagccatgggctt
accgtggccgactcttggcaagccgtagtgcaccatccggatgtggatctagtctgtgtg
gcccacctgaatcgagatcatgccccagtagtcgccgccgccttgcaagcccacaagcat
gtcatcgtagaataccccctggccttttccccccagcagggccagcaactgctggcccta
gcccgcgcccagcagcgcctgttgcacgtggagcatatcgagttactagggggcttacat
caagccatgcagcagcatctgcccgccattggggccccctcctacgtgcgctatagcacc
ctcaagccccagcgtccggcgccgaccaagtggacctatcgccccgccgaattcggcttt
cccctagtgggggccctgtcgcgtatccatcgcctcacccatctatttggtcccatcacg
gcagtgacctgccaacttcagtacgacggcgtcatcagccgtactacccccgaggccttc
acctcctgtctctgcattggtcaatttcagtttcagagcggactgttggcggaagtcagc
tatggcaagggagagctgatctggcaggtaacccgccgcatggaaatctatggccagacc
ggtgccctggtgttcgaagccgatcacggcacattgatacgcccagaggacacccaaccc
atagtagtggggtcccgacgggggttatttaagcgagacacacagatggtcttagaccac
ctcagcagtggcacccccctctatgtgacgccgcaacagagcttactctctctggcagtg
gccgacgccgctcgtcgttcggcagaaaccggcgagatggtacggctgtga

DBGET integrated database retrieval system