KEGG   Halomicronema hongdechloris: XM38_035020Help
Entry
XM38_035020       CDS       T04928                                 

Gene name
udk
Definition
(GenBank) Uridine kinase
  KO
K15918  D-glycerate 3-kinase [EC:2.7.1.31]
Organism
hhg  Halomicronema hongdechloris
Pathway
hhg00260  Glycine, serine and threonine metabolism
hhg00561  Glycerolipid metabolism
hhg00630  Glyoxylate and dicarboxylate metabolism
hhg01100  Metabolic pathways
hhg01110  Biosynthesis of secondary metabolites
hhg01130  Biosynthesis of antibiotics
hhg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XM38_035020 (udk)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    XM38_035020 (udk)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XM38_035020 (udk)
Enzymes [BR:hhg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.31  glycerate 3-kinase
     XM38_035020 (udk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_33 PRK ABC_tran Zeta_toxin AAA_16 AAA_18 AAA_28 ATP_bind_1 cobW
Motif
Other DBs
NCBI-ProteinID: ASC72544
UniProt: A0A1Z3HQF0
Position
3693414..3694463
Genome map
AA seq 349 aa AA seqDB search
MDQPSSILTRWLAGASPTDADWQALMATELADQRRANAWGIRDDTVRSALRRRWHLLQQL
ALEHRQIPVPHGSLTDLLPWLWFLWLPLTLWLVEARQRLNRPLIQGILGGQGSGKTTLTR
VLQQLLTLVGQHGVTLSIDDLYKTYADRQILRQQDPRLIWRGPPGTHDIELGLRTLQQLR
QAPPDAAIPIPRFDKSAHGGEGDRISPEWVSQVDIVLFEGWFVGARPVDPAQIATAPWPI
ETEADRQFAADMNQRLRDYLPLWEQLDQLMVLYPEDYRLSQQWRRQAEQAMKADGKSGMA
DDTVDQFVEYFWRALHPALFIEPLCHRREWVDLVVEIRADRTLKAVYAP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggatcagccctcgtctatcctcacccgttggctagcgggcgcctcccctactgatgct
gactggcaggcattgatggctacggaattggctgaccagcgccgagccaatgcctgggga
attcgagacgatacggttcgttcagcactgcggcggcggtggcacttattacagcaacta
gcccttgaacataggcaaattccagttccccatggctccctgactgatctattgccttgg
ctctggttcctgtggttaccattgaccctgtggttggtggaggctaggcagcgactgaac
cgtcctttgattcaagggatcttgggcggacagggcagtggcaaaacgactctaacgcga
gtcttgcagcagctgttaacgctagtggggcaacatggggtcaccctatctatagatgat
ttatacaaaacctatgctgaccgtcagattttgcgccaacaggatccccggctgatttgg
cgtggtcccccaggcactcatgatattgagttagggctgcgaacattgcagcagttgcgt
caggcacctccagatgcagcgattcccatcccacggtttgataaatcggcccatggaggt
gaaggcgatcgcatctctccggaatgggtgagtcaggtggatatcgtgctctttgaaggc
tggtttgtgggagcgcgtcccgttgacccagcccagattgccacagccccttggcctatt
gagacagaggctgatcgtcaatttgccgcggatatgaaccaacgcctgagggattactta
ccgctttgggagcagttggatcagttaatggtgctctatccagaagattatcgccttagc
cagcagtggcgtcgccaagcagaacaagccatgaaggcggatggtaaatcagggatggca
gatgacaccgttgaccagttcgtagagtacttttggcgggcgttgcatccggccctgttt
atcgagccgctatgtcatcgtcgggagtgggtcgatttagtggttgaaattcgtgcggat
cgaactttgaaggcagtgtatgctccctag

DBGET integrated database retrieval system