KEGG   Halomonas hydrothermalis: CLM76_01480Help
Entry
CLM76_01480       CDS       T05117                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
hhh  Halomonas hydrothermalis
Brite
KEGG Orthology (KO) [BR:hhh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CLM76_01480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ATH76358
UniProt: A0A291JQD8
Position
complement(331463..331840)
Genome map
AA seq 125 aa AA seqDB search
MSGLEVEVSVTPEFQDAESSASEARYVFSYTVTVHNQSPHSVQLMARYWKITQGNGESQE
VRGKGVVGQQPLIGPGQRFRYTSRAILQTPVGVMEGAYTLLNTYTQRAFDVPVSPFRLAV
PRQLH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggctggaggtcgaggtcagcgtcacgccagagtttcaggacgccgagtcgagt
gccagcgaggcccgctacgtattcagctataccgtgacggtgcacaaccaaagcccccat
agcgtgcagctgatggcacgctactggaaaatcacccagggcaatggcgagagccaggaa
gtgcgcggcaagggcgtggtgggtcagcagccgctgattggcccggggcaacgtttccgc
tataccagccgagcgatactgcaaaccccggtaggtgtcatggagggtgcttacaccttg
ttgaacacctacacccagcgggcgttcgatgtgcccgtctcgccttttcggttagcggtg
ccccgccagctgcattga

DBGET integrated database retrieval system