KEGG   Halomonas hydrothermalis: CLM76_03530Help
Entry
CLM76_03530       CDS       T05117                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
hhh  Halomonas hydrothermalis
Pathway
hhh00270  Cysteine and methionine metabolism
hhh00920  Sulfur metabolism
hhh01100  Metabolic pathways
hhh01110  Biosynthesis of secondary metabolites
hhh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hhh00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CLM76_03530
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CLM76_03530
Enzymes [BR:hhh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     CLM76_03530
    2.3.1.46  homoserine O-succinyltransferase
     CLM76_03530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Peptidase_S9 Esterase
Motif
Other DBs
NCBI-ProteinID: ATH76727
UniProt: A0A291JRE1
Position
771436..772632
Genome map
AA seq 398 aa AA seqDB search
MPDSDTLAFADRPADSVGLVTPHVAKFDTPLPLACGKTLPEYELIYETYGTLNAERSNAV
LICHALSGHHHAAGYHSAEDRKPGWWDAHIGPGKSIDTNRFFVVSLNNLGGCHGSTGPVS
HNPDTGRQWGPDFPVITVNDWVASQARLADHLGIERWAAAVGGSLGGMQVLQWSITYPER
VANAVIIAATPRLSAQNIAFNEVARQAIRSDPEFFDGWYAEHDTVPRRGLKLARMVGHIT
YLSEDAMGSKFGRDLRSDDLNFGFDVEFQVESYLRYQGDTFSTAFDANTYLLMTKALDYF
DPAASHGGDLAQALAPAQCPFLIVSFTTDWRFPPSRSRELVDALTQAGKSVSYANIDSPH
GHDAFLLPEPRYHALFSAFMGRVARELKIDAVAKKEAR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcctgattcagacactcttgcttttgctgaccggccagcggactccgtgggtctggtc
acaccacacgttgccaaatttgacacgccgctgccgctcgcctgcggcaagacgctgccg
gaatacgagctgatctatgaaacctacggcacgctcaacgccgagcgctccaacgcggta
ctgatctgtcacgcgctctccggccaccaccatgcggcgggctaccactctgccgaggac
cgcaagcccggctggtgggatgcccatatcggcccgggcaaatccatcgacaccaaccgt
ttcttcgtggtgtcgctgaacaacctgggcggctgccacggcagtaccggccccgtcagc
cataacccagacaccggtcgccagtgggggcctgacttccccgtgatcacggtcaacgac
tgggtggccagtcaggcgcgcctggccgaccacctgggcatcgagcgctgggccgcggcc
gtgggtggcagcctgggcggcatgcaggtgctgcagtggagcatcacgtacccggagcgg
gtggccaatgcggtcatcattgccgccacgccccgcctgtcggcccagaacatcgccttc
aacgaggtggctcgtcaggccattcgctccgacccggagttcttcgatggctggtacgca
gagcacgacacggtgcccaggcggggcctgaagctggcgcggatggtcggtcatatcact
tacctctccgaagacgccatgggcagcaagtttggccgcgacctgcgcagcgacgacctg
aatttcggcttcgatgtcgagttccaggtggagtcctacctgcgttatcagggcgatacc
ttctccaccgccttcgatgccaatacctatctgctgatgaccaaggcgctggactacttc
gaccctgccgccagccacgggggcgaccttgcccaggcgctggccccggcccaatgccct
ttcctgatcgtcagcttcaccaccgactggcgcttcccaccctcgcgttcccgtgagctg
gtggatgccctgacccaggcgggcaaatcggtcagctatgccaatatcgactcccctcac
ggccacgatgccttcctgctgcctgaaccccgctaccacgcgctgttcagtgccttcatg
ggtcgcgtcgctcgcgagctgaagatcgacgccgtcgccaagaaggaggctcgttaa

DBGET integrated database retrieval system