KEGG   Halomonas hydrothermalis: CLM76_09970Help
Entry
CLM76_09970       CDS       T05117                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
hhh  Halomonas hydrothermalis
Pathway
hhh00620  Pyruvate metabolism
hhh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLM76_09970 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hhh02000]
    CLM76_09970 (oadA)
Enzymes [BR:hhh01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     CLM76_09970 (oadA)
Transporters [BR:hhh02000]
 Other transporters
  Primary active transporters [TC:3]
   CLM76_09970 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N Peptidase_M23 GCV_H TGT
Motif
Other DBs
NCBI-ProteinID: ATH77901
UniProt: A0A291JUK9
Position
2101809..2103635
Genome map
AA seq 608 aa AA seqDB search
MNDVKRPLGITDVVLRDAHQSLFATRLRLDDMLPIAEKLDKVGYWSLETWGGATFDACIR
YLGEDPWERIRALKEAMPNTPQAMLLRGQNLLGYRHYADDVVDKFVERAKTNGVDVFRVF
DAMNDPRNLERAIKAVRAVGGHAQGTISYTVSPVHTLDSWVDLAKTIANMGADSLAIKDM
AGLLTPYTAFDLVTRLKKELSIPVHLHCHATTGLSTSTILKAVEAGIDNVDTAISSMSMT
YGHSPTESVVAMLKDTDRDTGLDLELLEDIAGYFREVRKKYAAFEGSLRGIDSRILVAQV
PGGMLTNMESQLKEQGAGDKLDDVLSEIPRVREDLGFIPLVTPTSQIVGTQAVMNVMMGE
RYKSISKEVQALLKGEYGSAPAPFNAELQKRVLEGGEPITCRPADNLSPEMERLATELKE
KASADKLRLAEGERQVDDVLTYALFPQIGLKFLKNRDDKEAFEPAPQVETKAAVPAKAEP
AAPAAMVNSGPETYTVKLNGKAYVVEVSPGGDIGEIKEQAAASGGASAGAGAAESAGGSG
ESIDAPLAGNIFKVNVRPGDQVAEGDVVIILEAMKMETEVRASSAGTVSKVNVSEGDSVA
VGDALIEL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgtaaaacgcccgttaggaatcactgatgttgtgctgcgcgatgcccaccag
tcgctattcgcgactcggcttcggctcgatgacatgctgcctatcgccgaaaagctcgac
aaggtcgggtactggtcgctggagacttggggcggcgccaccttcgatgcctgcattcgc
tatctgggtgaagacccctgggagcgcattcgcgccctgaaagaggcgatgcccaacacg
ccgcaggcgatgttgctgcgcgggcagaacctgctgggctaccgtcactatgccgacgac
gtggtcgacaagttcgtggagcgagccaagaccaacggggtcgatgtgttccgcgtgttc
gacgccatgaatgacccgcgtaatctggagcgtgccatcaaggcagtgcgtgccgtgggt
ggtcatgcccaggggaccatttcctataccgtcagtccggtacataccctggatagctgg
gtagatcttgcgaagaccattgccaacatgggcgcagattctctggctatcaaggatatg
gcgggactgttgacgccttacacggcgttcgacctggtgacgcgcctgaagaaagaactc
tccattcccgtccacctgcactgccacgcgaccacagggctctcgacgtccaccattttg
aaggccgtggaggctggcatcgataacgtggatacggccatctcatcgatgtcgatgacc
tatggacacagccccaccgaatccgtggtggcgatgctcaaggacacggaccgtgacacg
gggctggacctggagctgctggaagacattgccggttacttccgtgaggtacgcaagaag
tatgcagcgttcgagggctcgctgcggggtatagactcacgcattctggtggcgcaagtg
ccgggcggcatgctgaccaacatggagagccagctgaaagagcagggcgctggcgacaag
ctggacgacgtactgagtgaaattccgcgcgtacgtgaagacctgggcttcatcccgctg
gtgacgccgacctcgcagatcgttggcacccaggcagtgatgaacgtcatgatgggcgag
cgctacaagtcgatttccaaagaggtccaggcgctgttgaaaggcgaatacggctcggca
cctgcccccttcaatgcggagctgcaaaagcgcgtgctggaaggcggcgagccgatcacc
tgccgtcctgcggacaacctgtcaccagagatggagcgcctggccacggagctgaaagag
aaagccagtgccgacaagctgcgcctggcagaaggcgagcggcaggtggatgacgtgctg
acctacgcactcttcccgcaaattggcctcaagttcctcaagaaccgtgacgacaaggaa
gccttcgagcccgcgccacaagtagaaacaaaggcagccgtgcctgccaaggcagaaccg
gctgcacctgctgctatggtcaacagcggtccggaaacctataccgtcaagctcaacggc
aaagcctatgtggtcgaggtatctccgggtggcgatattggcgagatcaaggagcaggct
gccgccagtggaggcgctagtgctggagcgggtgcggcagaaagcgctggaggtagcggc
gaaagtatcgatgcgccgctggcaggcaatatcttcaaggtcaacgtacgccccggcgac
caagtggccgaaggcgacgtggtcatcatcctcgaagccatgaaaatggagaccgaagtg
cgtgccagcagcgcaggaacggtatccaaggtcaatgtcagcgagggcgatagcgtcgcc
gttggcgatgcgctgatcgagctttaa

DBGET integrated database retrieval system