KEGG   Halomonas hydrothermalis: CLM76_10380Help
Entry
CLM76_10380       CDS       T05117                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
hhh  Halomonas hydrothermalis
Pathway
hhh00260  Glycine, serine and threonine metabolism
hhh01100  Metabolic pathways
hhh01110  Biosynthesis of secondary metabolites
hhh01120  Microbial metabolism in diverse environments
hhh01130  Biosynthesis of antibiotics
hhh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hhh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLM76_10380
Enzymes [BR:hhh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CLM76_10380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Rtt106
Motif
Other DBs
NCBI-ProteinID: ATH77974
UniProt: A0A291JUS6
Position
complement(2197841..2198857)
Genome map
AA seq 338 aa AA seqDB search
MIDLRSDTVTRPTSAMRAAMLAAPLGDDVWGDDPTVNAFQATLAERTGKEAALLFPSGTQ
SNLVALMAHCERGDEYIVGQNAHTYRYEGGGAAVLGSIQPQPIEHAADGSLPLDKIAAAV
KADDVHFARTRLLALENTIGGKVLPAEYVQQATELARAHGLATHLDGARLFNAAVATDTS
LKQLCQPFDSVSLCFSKGLGTPMGSALVGSHALIERARRWRKMVGGGMRQAGIIAAACQH
ALDHHVADLAHDHRRAARLAEGLAALPGLEVTSHATNMVFLRVDQAHVAPLAAWLKEHDI
LIQLLYATRLVIHRDIDDAAVERVLEVMGRYFDAAASR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgtagcgatacggtcactcgccccacctccgcgatgcgggcagccatg
ctggcagcgcctctgggcgacgatgtctggggcgacgacccgacggtcaatgcctttcaa
gcgacccttgccgagcgcacgggcaaggaggctgccctgctgttccccagtggcacccaa
agcaatctggtggcgctcatggcgcactgcgaacgcggcgatgagtacatcgtgggccag
aatgctcatacttaccgctacgaaggcggcggcgccgccgtgttgggcagcatccagcca
cagccgatagaacacgccgcagacggcagcctgccactcgacaaaatcgctgccgccgtc
aaagccgacgacgttcactttgcccgtacgcggctcctggcgctggaaaacaccatcggt
ggaaaagtgctgcccgccgagtacgttcagcaggccaccgagctggcgcgcgctcacggg
ctggcaacgcacctggacggcgctcggctcttcaatgccgccgtcgccacggatacctcg
ctgaagcagctgtgccagccgttcgatagcgtgtcactctgcttttcgaaagggctgggc
acgcccatgggttcggcgctggtagggtcgcacgcgttgatcgagcgcgcacggcgctgg
cgcaagatggtagggggcggcatgcgccaggcgggcatcatcgccgcggcctgccagcat
gccctcgaccatcacgtggccgacctggcccatgatcatcgccgcgcggcgcgtttggca
gaagggttggcagcgctgcccgggctcgaggtcacctctcacgccaccaacatggtgttc
ttgcgcgtcgatcaagcccacgtggccccgctggctgcctggctgaaagagcacgacatt
ctgatccagctgctttacgccacgcgactggtgatccatcgcgatatcgatgacgccgct
gtcgagcgtgtgctggaggtcatggggcgctacttcgacgcggcggcatcacgatag

DBGET integrated database retrieval system