KEGG   Halomonas hydrothermalis: CLM76_13770Help
Entry
CLM76_13770       CDS       T05117                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
hhh  Halomonas hydrothermalis
Pathway
hhh00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:hhh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CLM76_13770
Enzymes [BR:hhh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CLM76_13770
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CLM76_13770
    1.1.1.-  
     CLM76_13770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C TrkA_N ADH_zinc_N_2 NAD_binding_3 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ATH79570
UniProt: A0A291JZ96
Position
2944799..2945848
Genome map
AA seq 349 aa AA seqDB search
MQAAVWYAARDLRVEQVPVPTINDPHSVKVKVAACGICGSDLHEYAAGPIFIPVGKPHPI
SGEQAPIIMGHEFAGEVVEVGEKVIRVKVGDRVAIEPILSPNKDGAYQMERYNLTPLLGF
HGLSGGGGGFSEFTVMGEHMVHKLPDDLSFEQGALVEPAAVALHAVRQSCLKAGDSAAVF
GAGPIGLMTIEALKAAGAAQIYAIEVAPSRKAKAEALGAIVVDPQQEDVVEKLHALSEGG
VDVAFEVTGIPAVLNQALHSTHEGGEVVVVSIWEGDASFQPNDLVIKERTMKGIIAYRHV
YPAVMALMQRGYFRAEDMVTQRIPLVNIVEEGFEALLSDKAQVKIIVTP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagcggtgtggtatgcggccagggatcttcgcgtggagcaggtgcctgtgcca
accattaacgaccctcactcggtgaaggtgaaagtggccgcctgtgggatttgcggcagc
gatttgcatgaatacgccgctgggccgattttcatcccggtgggcaagccgcaccccatc
agcggcgaacaggcgccgatcatcatgggccatgagtttgcgggggaagtagtggaggtc
ggtgaaaaagtcatccgcgtgaaggtgggggatcgcgtcgccatcgagccgatcctgtcg
cccaacaaggatggcgcttaccagatggagcgctacaacctgacgccgctgctcggcttc
cacggcctttccggtggcggcggtggtttttccgagttcaccgtcatgggcgagcacatg
gtacacaaactgccggatgacctgagcttcgagcaaggggccctggtagaacccgccgcc
gtggcgctgcatgcggtgcgccagagctgcctgaaggctggggatagtgctgcggtgttc
ggcgccgggccgattggcctgatgaccatcgaggccctcaaggccgccggggctgcgcag
atctacgcgatagaagtcgcgccatcccgcaaagccaaagccgaagcgttgggggccatc
gtggtcgaccctcagcaagaagacgtcgtggagaagctgcacgcattgagcgagggtggg
gtcgatgtggcgttcgaagtcaccggcattcccgccgtgctcaatcaggcgctgcacagt
acccacgaaggcggcgaagtggtggtagtgagcatttgggagggtgacgccagcttccag
cccaatgacctggtcatcaaggagcgcaccatgaaaggcatcattgcctatcggcatgtc
tatccggcggtgatggcgttgatgcagcgaggctacttccgagccgaagacatggtcacc
cagcgtattcctctggtcaacatcgtcgaagagggcttcgaggcgctgttgagcgacaag
gcgcaggtgaaaatcatcgtcacgccctag

DBGET integrated database retrieval system