KEGG   Halomonas hydrothermalis: CLM76_15415Help
Entry
CLM76_15415       CDS       T05117                                 

Definition
(GenBank) ADP-ribose pyrophosphatase
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
hhh  Halomonas hydrothermalis
Pathway
hhh00760  Nicotinate and nicotinamide metabolism
hhh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CLM76_15415
Enzymes [BR:hhh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     CLM76_15415
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     CLM76_15415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like FAD_syn NUDIX_4
Motif
Other DBs
NCBI-ProteinID: ATH78896
UniProt: A0A291JXI1
Position
3293521..3294615
Genome map
AA seq 364 aa AA seqDB search
MTLDAAPTTSTHEFDCLVFIGRFQPPHLGHLAIIREALKQARQVIVMVGSSWQARSLRNP
WHFNERQAMIRSAFDEAENRRLEITPLLDALYNDDVWVRDVQRKVRDLATPANVRLPRIG
LIGASRGQSSYYLSLFPQWESVSVPLVEGISASQIRERLFRSPDATGDYLSTGAFHDLPP
GVVKSVGQFCKGDAYHQLLEEQHLLDQYRQAWAKAPYPPIFVTVNAVVVQSGHVLLVKRT
AAPGKGLFALPGGFINPHERLLDACLRELRERLRLKVPEPVLKGSLRGQRLFDEPHRSWR
GRTLAEAFYFALTPDQQLPRLKPVKGGEHARWVALADLEPESLFEDHFFIIQNFLGLPAN
LGGV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacattggatgcggcccccacgacatcgacccacgaattcgactgcctggtattcatc
ggtcgttttcagccgccgcacctgggccatttggccatcatccgcgaagccctcaaacag
gcacgtcaggtcatcgtcatggtcggctcttcgtggcaagcgcgctccttgcgtaaccct
tggcacttcaatgagcgtcaggccatgatccgctcggcgttcgacgaggccgagaaccgc
cgcttggaaattaccccactgctggacgctctttataatgacgatgtctgggtacgggat
gtacagcgcaaagtgcgtgacctggccactccagccaacgtgcgcctgccacgtatcggc
ctgatcggagccagtcgaggccaatccagctactatctttcgctgtttcctcagtgggag
tcggttagcgttccgctggtggagggaatttcagcaagtcagattcgtgagcgtctattt
cgctcaccggacgccaccggcgactatctaagcaccggagcgtttcacgacctccccccc
ggagtggtcaaaagcgtggggcagttctgcaagggcgacgcctatcatcaactgctggag
gagcagcacttgctggaccagtatcgccaggcatgggccaaggctccctacccgcccatt
ttcgtcacggtgaatgccgtggtggtacaatccggccatgtgttgttggtcaagcgtacc
gccgccccgggcaaggggctgtttgccctgcccggcggcttcatcaatccccacgaacgc
ctgctggatgcctgcctgcgcgagctgcgcgaacgcctgcggctcaaggtgccggagccg
gtgctgaaaggatcgctacgcggccagcgtctgttcgatgagccccatcgcagctggcgc
gggcgcacgctggccgaagccttctactttgcgctgactcccgaccagcagctacctcgc
ttgaagccggtcaaaggcggcgagcatgcccgatgggtggcgctggccgacctggagcca
gaaagcctgtttgaggatcacttcttcatcattcaaaactttctagggctaccggccaac
ctgggcggcgtttag

DBGET integrated database retrieval system