KEGG   Haloarcula hispanica ATCC 33960: HAH_0990Help
Entry
HAH_0990          CDS       T01597                                 

Gene name
folP2
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
hhi00790  Folate biosynthesis
hhi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HAH_0990 (folP2)
Enzymes [BR:hhi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HAH_0990 (folP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEM56608
UniProt: G0HWR5
Position
I:complement(941048..942205)
Genome map
AA seq 385 aa AA seqDB search
MRTVEIDGLPVGDGHPTRVMSVLNMSSNSGYKPSVYLDPAEAADAIEENLVPAGADIIDV
GLQSANPKYESKPVEMEKDRLEEVAPLVDELDADVPLSLETRYAEVAEEAIGHGFDLIND
VCGFADPEMKGVVEDHDMPVVKMASPPDLARPGALKSIDDIFEALQRDGFTDKTIIDPAF
GGWYDGKEFEDNWEMFRRLREFRAFDRPMLTATNREDFLGDLADQPETENQLAVSLAAAT
MEVERGAHIIRTHDTRETHDVVKVADALGDERTTRAETEPGPTVAELTDVTLREVARHQA
LGETVAGGTDDGATLTFLLGDLTDDARASLRAVAEVTDVVVVEKDSGSLYVGGAAVALKV
VADSLAEDGHRELAGELRASLSRRV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacggtcgaaatcgacggcctcccggtgggtgatgggcacccgacacgcgtcatg
agcgtgttgaacatgagttcgaactccgggtacaagccgagcgtgtatctggaccccgcg
gaagccgccgacgcaatcgaggagaacctcgtccccgccggcgcagacatcatcgacgtc
ggcctccagtcggccaaccccaagtacgagtccaagccggtcgagatggagaaagaccgg
ctcgaagaggtcgcgccgctcgtcgacgaactcgacgccgacgtgccgctgtcgctcgaa
actcggtacgcagaggtcgccgaggaggccatcggccacgggtttgaccttatcaacgac
gtgtgtggcttcgccgacccggagatgaaaggtgtcgtcgaagaccacgacatgccggtc
gtcaagatggccagtccgccggacctggcccggcccggcgcgctgaagagcatcgacgac
atcttcgaggcgctccagcgggacgggttcacggacaagacaatcatcgacccggcattc
ggcggctggtacgacggcaaggagttcgaggacaactgggagatgttccgccgcctccga
gagttccgcgccttcgacagaccgatgctcacggcgaccaaccgcgaggacttcctcggt
gacctggccgaccagcccgagacggagaaccaactcgccgtgtcactggctgcggcgacg
atggaagtcgaacgcggggcccacatcatccgaacgcacgacacacgcgagacccacgac
gtggtcaaggtggccgacgcgctcggcgacgagcggacgacgcgtgccgaaactgagccc
ggccccaccgtggcggaactgaccgacgtgacgctgcgggaggtggcccggcatcaggcc
ctcggcgagacggtcgccggcggcaccgacgacggcgcgacgctgacgttcctgctcggt
gacctgaccgacgacgcacgggcaagtctccgggccgtcgccgaggtgaccgacgtggta
gtcgtcgagaaagacagcggcagcctctacgtcggcggcgccgcggtagcactgaaagtg
gtcgccgacagcctcgccgaagacggccaccgcgaactcgccggcgagttgcgagcgtcg
ctatcgcggcgtgtgtag

DBGET integrated database retrieval system