KEGG   Haloarcula hispanica ATCC 33960: HAH_1150Help
Entry
HAH_1150          CDS       T01597                                 

Gene name
araL1
Definition
(GenBank) arabinose operon protein AraL
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
hhi00627  Aminobenzoate degradation
hhi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HAH_1150 (araL1)
Enzymes [BR:hhi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     HAH_1150 (araL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like Hydrolase_6 Hydrolase HAD_2 PGP_phosphatase Hydrolase_3 Bse634I
Motif
Other DBs
NCBI-ProteinID: AEM56765
UniProt: G0HXN3
Position
I:complement(1083143..1083946)
Genome map
AA seq 267 aa AA seqDB search
MVVMTVEGVIVDLDGTVYHGETLLPGAASAIDVLRERGLGICFFSNNPIHDGSEYVERLR
GMGVDAREGEACSSGVVTREYLNGSHAEDNVFVIGSDQLRGLVEGTNARLVEDPAETDVL
LASWTDGFHYHDMVDALRAIDEETVFLGTDPDRTFPGEDGDPVPGSGAIINAVAGVIERD
PDRILGKPSEIAVQAALERLDCAPADCLIVGDRLETDIAMGERNGMTTVLVRTGVSNERS
LERSAVTPDYVIDSLADIEQVLTSLDR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtaatgacagtcgagggggtcatcgtcgacctggacggaacggtgtaccacgga
gaaacgttgttgccgggcgcggcgtcggcaatcgacgtgctcagggagcgaggcctggga
atctgctttttttcgaacaatccgatccacgacgggagcgagtacgtcgagcgcttgcgt
gggatgggcgtcgatgcccgcgagggtgaggcctgttcctccggcgtcgtcacccgcgag
tacctcaacgggtcccacgcggaggacaacgtgttcgtcatcgggagcgaccaactccgc
ggtctggtcgaagggacgaacgcacgcttagtcgaggaccccgccgagaccgacgtgtta
ctggcctcctggacggacggcttccactaccacgatatggtcgacgcgctccgggccatc
gacgaggaaaccgtcttcctcgggactgacccggaccggacgttccccggcgaggacggc
gacccggtccccggttccggggcgataatcaatgccgttgccggcgtcatcgagcgggat
ccggaccggatactcgggaagccgtcagagattgctgttcaggcggcgctagaacggctg
gactgtgcgccggcggattgtctcatcgtcggtgaccggctggagacggacatcgcgatg
ggcgagcggaacgggatgacgactgtgctcgtccggaccggcgtatccaacgagcggtcg
ctggaacggagcgccgtgacgcccgactacgtcatcgattcactggcggatatcgagcag
gtgcttacatcgctcgacaggtga

DBGET integrated database retrieval system