KEGG   Haloarcula hispanica ATCC 33960: HAH_2476Help
Entry
HAH_2476          CDS       T01597                                 

Gene name
aceB
Definition
(GenBank) malate synthase
  KO
K19282  bifunctional (S)-malyl-CoA lyase/thioesterase [EC:4.1.3.24 3.1.2.30]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
hhi00630  Glyoxylate and dicarboxylate metabolism
hhi01100  Metabolic pathways
hhi01120  Microbial metabolism in diverse environments
hhi01200  Carbon metabolism
Module
hhi_M00740  Methylaspartate cycle
Brite
KEGG Orthology (KO) [BR:hhi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HAH_2476 (aceB)
Enzymes [BR:hhi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.30  (3S)-malyl-CoA thioesterase
     HAH_2476 (aceB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     HAH_2476 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AEM58063
UniProt: G0HXZ0
Position
I:2397216..2398523
Genome map
AA seq 435 aa AA seqDB search
MSVKRHYDREFVRTFFTSPTAVDGEDDSAKMLRSAGQLRGLQAPDVWVPDNEDATAPNMR
EEGVENIIEVVSEQGAEFPGEIHPRVVWHRESPTTRYQGFQQMLEITDPENGAVEHIDGF
VIPEVGDIDDWKKADEFFTIIEHEHGLEEGSLSMSVIVESGEAELAMGDLREEMGKPSNN
LERMFLLVDGEVDYTKDMRAMTPTGELPPWPELRHNTSRGASAAGLIAVDGPYDDIRDVE
GYRERMKDNRAKGMTGIWSLTPGQVVEANTAPLPPKTGSWLLDVGGQEVELDAQDGKQVY
DGDDLSLETDGEGGYVLQAGGDRLELDEDELTEELLDRTAYIPSMTDIVDSMEEFEAAKE
AGKGAIAMTQAATLVIDGVEVEVSKDRMWDEATYQAAQTPITLFQDVYEHRPDQHEELAE
MYGTDIVERATAVGN
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaaacgacactacgaccgcgagttcgtcagaacgttctttacctctccaaca
gcagtcgacggggaggacgattcagcgaagatgctgcgaagcgcgggccagctccgcggc
ctgcaggccccggatgtctgggtcccggacaacgaggacgcgacggcaccgaacatgcgc
gaggagggcgtcgagaacatcatcgaagtggtctcagaacagggtgccgagttccccggc
gagatccacccgcgcgtcgtctggcaccgcgagtccccgacgacccgctatcagggcttc
cagcagatgctcgaaattaccgaccccgaaaacggtgcggtcgagcacatcgacggcttc
gtcatcccggaggtcggcgacatcgacgactggaagaaggccgacgagttcttcaccatc
atcgagcacgagcacggactggaggaggggagcctctccatgtcggtcatcgtcgagagc
ggcgaggccgaactggcgatgggcgacctgcgcgaggagatgggcaagccctcgaacaac
ctcgaacgtatgttcctgctcgtcgacggcgaggtcgactacacgaaggatatgcgcgcg
atgacgcctaccggcgaactcccgccgtggccggaactgcgccacaacacctcccgcggt
gccagcgccgccggccttatcgccgtcgacggcccctacgacgatatccgcgacgtcgag
gggtaccgcgagcggatgaaggacaaccgcgcgaaggggatgactggcatctggtcgctg
acaccggggcaagtcgtggaggcgaacacggccccgctcccgccaaagaccgggagctgg
ctgctcgacgtcggcggtcaggaggtcgaactcgacgcacaggacggcaagcaggtgtac
gacggcgacgacctctcgctggaaacggacggcgagggcggctacgtcctgcaggcgggc
ggtgaccggctggaactggacgaggacgaactcaccgaggaactgctcgaccgcaccgcg
tacatccccagcatgaccgacatcgtcgactcgatggaggagttcgaggccgcgaaggag
gccggcaagggagccatcgcgatgactcaggccgcgacgctggtcatcgacggcgtcgaa
gtcgaggtcagtaaagaccggatgtgggacgaagcgacctaccaggccgcccagacaccc
atcacgctgttccaggacgtgtacgagcaccgcccggaccagcacgaggaactggcggag
atgtacggcactgacatcgtcgaacgcgccacggctgtcggcaactaa

DBGET integrated database retrieval system