KEGG   Haloarcula hispanica ATCC 33960: HAH_3008Help
Entry
HAH_3008          CDS       T01597                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hhi  Haloarcula hispanica ATCC 33960
Brite
KEGG Orthology (KO) [BR:hhi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HAH_3008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AEM58582
UniProt: G0HTL6
Position
I:2892794..2893993
Genome map
AA seq 399 aa AA seqDB search
MVATSTIATLVVASAASLFMAWAIGAGSSGSTPFAPAVGANAISVMRAGFFVGILGLAGA
VLQGANVTEAVGSELVLFPSGGGLSAIAAIVALITAAVLVAIGIFTGYPIATAFTVTGAV
VGVGLAMGGQPATAKYLEIVSLWVLTPFVGGGIAFGTAWSLRHETTTEERLVPLLGGLVG
VILANIEFVLLAPGSRQASVARAVARAAGTPIFPSMVVVSLLAGVLAGGLLYLDIRADAA
AGQRHFLLVMGGLVAFSAGGSQVGLALGPLVPLLGEGPTAAIPITGVLLFGGLGLLIGSW
TGAPRMIKALAQDYSSLGPRRSIGALIPSFIIAQAAVFFGIPVSFNEIIVSAIVGSGAAA
GGGEVSREKMGKTVLAWIGSLALAFGLSYGLFWIIDALL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcgacgagtacgattgcgacgcttgttgtcgcgtcagccgcgagtctgttcatg
gcctgggctatcggtgccgggtcgtccgggtccactccgttcgcgccggccgtcggagcg
aacgcgatttcggtgatgcgggccgggtttttcgtcggcatcctcgggctggccggcgcg
gtcctgcagggggccaacgtcacggaggctgtcgggagcgaactcgttctgttcccgagc
ggcggcggcctctcggctatcgccgccatcgtcgccctcatcaccgcggcggtgctggtc
gccatcgggattttcactgggtaccccatcgcgacggcgttcaccgtcaccggtgcggtg
gtcggcgtcggactggcgatgggcggccagccggcgacggccaagtacctcgaaatcgtc
tcgctgtgggtcctgacgcccttcgtcggcggcggcatcgccttcgggacggcgtggtcg
ctccgacacgagaccacgaccgaggaacggctcgtaccgctgctgggcgggctggtcggt
gtgattctggcgaacatcgagttcgtgctcctcgcgccgggcagcaggcaggcgtcggtc
gcccgcgccgtcgcacgagcggctgggacgccaatatttccgtcgatggtcgtcgtatcg
ctccttgccggggtgcttgccgggggactgctgtacctggacatcagagcggacgcagcc
gccgggcagcggcacttcttgctggtgatgggtggactggtggccttctccgccggcggg
agccaggtcggcctggcgctggggccgctggtcccgctactcggtgaggggccgacggcg
gccattcccatcaccggggtcctgctgttcggcggactcggcctcctcatcgggtcctgg
acgggcgcgccgcggatgatcaaagcgctggcacaggactactcctcgctcggcccgcga
cgctccatcggcgcgttgattccgagtttcatcatcgcgcaggcggccgtcttcttcggc
attccagtgtcgttcaacgagatcatcgtctccgccatcgtcggctccggcgcggccgcc
ggcggcggcgaagtcagtcgtgagaagatgggcaagacagtgctggcctggatcgggtcg
ctcgcgctggcgttcggactgagctacggcctcttctggattatcgacgcactcctctga

DBGET integrated database retrieval system