KEGG   Haloarcula hispanica ATCC 33960: HAH_5106Help
Entry
HAH_5106          CDS       T01597                                 

Gene name
pitA
Definition
(GenBank) putative phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hhi  Haloarcula hispanica ATCC 33960
Brite
KEGG Orthology (KO) [BR:hhi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HAH_5106 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AEM59240
UniProt: G0I019
Position
pHH400:complement(111325..112566)
Genome map
AA seq 413 aa AA seqDB search
MVSLLLVLGLLVAGFVGFNIGGSSTGVAFGPAVGSKLVRKVTAAALFSVFAFIGAWTVGR
NVIVTMSEGIVPAAQFTPVAGVGVLFFTGLSLLVSNIYGVPASTSMTAVGAIVGLGLATG
SLNEALMFTIVSAWIVAPLIGLVIGAAIGRYAYPQLEARLSFTRLERQLVQIDRSGRFPR
LRLNRNASPRDLIGSALVLAIACYMGFSAGASNAANAVAPLVGNGAVSIDQGVLLAVAAI
SLGGFTIARRTLATVGDGITDLPILAALIVSSVGATIITVLSYYGIPASLAVSTTCCIIG
LGWGRASRAVTLTELATPPSESKPGPNLSTGALAAPSTEEEKPAGPTVGELAAGESPTPE
TSPSVPAIGEEDIEELTAENLFDPAATSRIVILWVLTPSLSVVGSYLLFALLL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggtctcgctgcttctcgtcctcggtttactcgtcgccgggtttgtgggatttaacatc
ggcggttcgtcaacaggcgtcgcgttcgggccggctgtcgggagcaagctggtcaggaag
gtaacagcggcggcactgttcagcgtgttcgcgttcatcggagcgtggacagtcggccgc
aacgtcatcgtcacgatgagcgaggggatcgtaccggccgcacagttcaccccggtagcc
ggtgtcggcgtcctgtttttcactggcctctcgctgctggtttcaaacatctatggcgtc
cccgcatcgacctcgatgacggctgtgggggcgattgtggggctcggactcgcgacggga
tcactcaacgaggcgttgatgtttacaatcgtctccgcgtggatcgtcgccccgctcatc
ggcctcgtcatcggggcggccatcggtcggtacgcctatccgcaactcgaagctcgactg
tcgtttacgcgcctcgaacggcagttggtacagatcgaccggtcgggccggttcccccgc
ctccgcctcaacagaaacgcgtccccccgtgacctcatcgggtcggcgctggtgttggcc
atcgcctgttacatgggtttcagcgcgggggcctcgaacgctgcgaacgcagtcgccccg
ctggtcggcaacggggccgtcagtatcgatcagggcgtgctcctcgcggtcgcagccatc
agcctcggtgggttcaccatcgccagacgcactctcgcaaccgtcggcgacggcattact
gacctaccgattctggcagccctcatcgtctcctccgtcggtgcgacgatcatcaccgtc
ctctcgtactacggcattccggcgagcctcgcggtgagcacgacctgctgtatcatcggt
ctagggtggggccgagcgagtcgcgctgtcacgcttacggaactcgcgacgccaccatcc
gagtccaagccggggccgaatctcagtactggcgctctcgccgccccatcaaccgaggaa
gagaagccagcgggtccaactgtgggcgaactcgcagccggagagtcccctacccccgag
acgtctccatcagtcccagccattggcgaggaggacatcgaggaactgaccgccgagaac
ctgttcgatccggcagcgacgagccggatcgtcattctctgggtcctcacgccgtcgctg
tctgtcgtcgggtcgtacctcctcttcgctctcctgctgtga

DBGET integrated database retrieval system