KEGG   Haloarcula hispanica ATCC 33960: HAH_5187Help
Entry
HAH_5187          CDS       T01597                                 

Gene name
fhs
Definition
(GenBank) formyltetrahydrofolate synthetase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
hhi00670  One carbon pool by folate
hhi00720  Carbon fixation pathways in prokaryotes
hhi01100  Metabolic pathways
hhi01120  Microbial metabolism in diverse environments
hhi01200  Carbon metabolism
Module
hhi_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:hhi00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HAH_5187 (fhs)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HAH_5187 (fhs)
Enzymes [BR:hhi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     HAH_5187 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AEM59320
UniProt: G0I099
Position
pHH400:complement(206840..208585)
Genome map
AA seq 581 aa AA seqDB search
MSSQDEQSATEETQEPIPTDYDIAQSTEMEPIWELVEPWGLGLDDLQYFGEYTAKVKQHA
IERLREQAEDKEQNLVLVTGMTPTPKGEGKTVTTVGLGQTLNHVGEEAMIAIREPSLGPV
FGVKGGAAGGGRSQVLPMEDINLHFTGDLHALTSAHNLIAAMLDAKISQGDDLNIDINNV
SWPRAIDMNDRALRETVVGLGGKTGGTPREDSFLLTAASELMAVLCLASDLGDLKERVSR
IIVAYDEDGDPVTVEDIEATGPATMLLRDAIKPNVVQTIEGTPALVHGGPFANIAHGTNS
LVADKTAFGMGDYLVTEAGFGSDLGAEKFMDVVCRKGDMTPNAVVLVASVRALKYHGLDQ
WPVDYDEIDEAGVEAVEAGFSNLDKHATNLQKFGVPVVVSVNRFPDDTDEEIQAILDHCR
EDLGVRAAESNVFSDGSEGGVDLAENVIEATEESNEEDFRMLYDDEDSIKEKIHTVATEI
YGADDVKYTGGALDDIEQMNELDFDDYPVVMSKTFHSLSDDASQKGAPEGWELEISEVYP
SAGAGFLVALTADALTMPGLPARPAAADMDIDEDGNISGLF
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacaggatgagcaatccgcgaccgaagagacgcaggagccgattcctacggac
tacgatatcgcccagtcgaccgagatggaaccgatctgggaactggtagagccgtgggga
ctcggcctcgacgacctccagtacttcggcgaatacaccgcgaaagtcaaacaacacgcc
atcgagcgcctccgtgaacaggcggaagacaaggagcagaacctcgtcctggtaaccggg
atgaccccgacgccgaaaggcgaggggaagacggtaacgaccgtcggcctcggacagacg
ctcaaccacgtcggcgaggaagcgatgatcgccatccgggaaccgtcgcttggcccggtg
ttcggcgtcaaaggcggcgcagcaggcggcggccggtcgcaggtccttccgatggaggac
atcaacctccacttcaccggcgacctccacgcgctcacctctgcacacaacctcatcgcc
gcgatgctcgacgcgaagatctcgcagggtgacgacctgaacatcgacatcaacaacgtc
tcctggccgcgcgctatcgacatgaacgaccgcgcgctccgggagacggttgtgggcctg
ggcgggaaaaccggcgggacgccacgggaggacagcttcctccttaccgccgcctcagaa
ctgatggcggtgctgtgcctggcgagtgacctgggcgacctcaaagagcgagtcagtcgc
atcatcgtcgcctacgacgaggacggcgacccggtcacggtcgaagatatcgaagcgacc
ggcccagcaaccatgctactccgggacgcgatcaagccgaacgtcgtccagaccatcgag
gggacgccggcgctggtccacggcgggccgttcgcgaacatcgcccacgggacgaactcg
ctcgtcgccgacaagactgccttcggcatgggcgactacctcgtcaccgaggctggtttc
ggctccgacctcggggccgagaagttcatggacgtggtctgtcgcaagggcgatatgacg
ccgaacgccgtcgtgctggtggcgtcggtccgcgcgctcaaataccacggcctcgaccag
tggccggtcgactacgacgagatcgacgaggccggcgtcgaagccgtcgaagcgggcttc
tcgaacctcgacaagcacgcgacgaacctccagaagttcggcgtcccggtcgtcgtctcc
gtcaaccgcttcccggacgacaccgacgaggagattcaggccatcttggaccactgccgt
gaggacctcggggtcagagcggctgagtcgaacgtgttctccgacggcagcgagggcggc
gtcgacctcgcggagaacgtcatcgaggcaaccgaggagagcaacgaggaggacttccgg
atgctgtacgacgacgaggacagcatcaaggagaagatccacaccgtcgcgaccgagatt
tacggcgctgacgacgtgaaatacaccggcggcgcgctcgacgacatcgagcagatgaac
gagctcgatttcgacgactacccggtcgtcatgtccaagacgttccactcgctgagcgac
gacgcgagccagaagggcgcgccggagggctgggaactcgaaatcagcgaagtgtacccg
tctgccggagctggcttcctggtcgctctcacggccgacgcgctcacgatgcctggcctg
ccggcccgaccggctgccgccgacatggacatcgacgaagacggtaacatttcggggctg
ttctga

DBGET integrated database retrieval system