KEGG   Haloarcula hispanica ATCC 33960: HAH_5201Help
Entry
HAH_5201          CDS       T01597                                 

Gene name
gcvT6
Definition
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
hhi00260  Glycine, serine and threonine metabolism
hhi00630  Glyoxylate and dicarboxylate metabolism
hhi00670  One carbon pool by folate
hhi01100  Metabolic pathways
hhi01110  Biosynthesis of secondary metabolites
hhi01130  Biosynthesis of antibiotics
hhi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HAH_5201 (gcvT6)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HAH_5201 (gcvT6)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HAH_5201 (gcvT6)
Enzymes [BR:hhi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     HAH_5201 (gcvT6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AEM59334
UniProt: G0I0B3
Position
pHH400:complement(226332..227708)
Genome map
AA seq 458 aa AA seqDB search
MTGNEEHPNHPSVDQSDRTVPRNLRQTGDPNIEMLVSTRVRKSPFFHKSFNEEGAWRATV
YNRLYHPRGLIEPEDGGVMKEYDALTNTVTLWDVAVERQIRVKGPDAEALTNYVVTRDVT
GMDAMDGKYVILCNEDGGVLNDPVLLRPEEDEFWFSISDSTLMQWLQGVNVDNDFDVEID
EIDVAPMQIQGPRALDVMVDVVGDKVKDVPYYGLMDAEINGCDVLISQTGFSGEKGFEVY
VKDAMENAEQVWDPVMESVKDHDGRQIAPGHHRRIAAGIMSWGQDLDHETSPFQVNLGYH
VPDDKEADYIGKEVLEEQKDQIENGNYPFEHKLIGLKIAGEPIRDYAPDFWLISDPDTGE
ECGYLTSPWWNPDLETNIGMGFVPAEKIQEVTDTPLNDEIYDEELDLEFQVHLPDEYADE
PGEPVFATAAKVPFKESVNPSAREQAKLNARKEAESDD
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtaacgaggaacatcctaaccatcccagtgtcgaccagtcagatcggactgtc
ccccgtaacctccgccagactggtgaccccaacatcgagatgttggtgtcaacgcgcgtt
cgaaagtccccgttcttccacaagtcgttcaacgaggagggtgcctggcgggcgaccgtc
tacaaccgcctctatcacccgcgcggtctcatcgagcccgaggacggcggcgtgatgaag
gagtacgacgcactgaccaacactgtcaccctctgggacgtcgccgtagagcgacagatt
cgggtcaaagggcccgacgccgaggcgctgacgaactacgtcgtcacccgcgacgtgaca
ggtatggacgccatggacggaaagtacgtcatcctctgtaacgaggacggcggcgtcctg
aacgaccccgttctcctgcgccccgaggaagacgagttctggttctccatctcggactcg
acgctgatgcagtggctgcagggcgtcaacgtcgacaacgacttcgacgtcgaaatcgat
gagatcgatgtggctccgatgcagatccagggcccgagggcgctcgacgtgatggtcgac
gtcgtcggcgacaaggtcaaagacgtcccgtactacggcctgatggacgccgaaatcaac
ggctgtgatgtgttgatcagccagaccggcttctcgggtgagaaaggcttcgaggtctac
gtcaaagacgcgatggaaaacgccgaacaggtctgggaccccgtcatggagtccgtcaaa
gaccacgacggtcgccagatcgcaccgggacaccaccgccggatcgccgccggtatcatg
tcctggggccaggacctcgaccacgagacctcgccgttccaggtcaacctgggctaccac
gttcccgacgacaaggaggccgactacatcggcaaagaggtcctcgaagagcagaaagac
cagatcgagaacggcaactacccgttcgagcacaagctcatcggcctgaagatcgctggc
gagccgatccgtgactacgcccccgacttctggctcatctccgacccggacacgggcgaa
gagtgtggctacctcacctcgccgtggtggaacccggatctcgaaaccaacatcgggatg
ggattcgtcccggccgagaagattcaggaagtcaccgacacgccgctcaacgacgagatc
tacgacgaggaacttgatctggagttccaggtccatctccccgacgagtacgccgacgag
cccggtgagccggtgttcgcgaccgccgcgaaagtgccgttcaaggagtctgtcaacccg
agcgcccgtgagcaggcgaagctcaacgcccggaaagaggccgaaagcgacgactaa

DBGET integrated database retrieval system