KEGG   Haloarcula hispanica ATCC 33960: HAH_5246Help
Entry
HAH_5246          CDS       T01597                                 

Gene name
tetR3
Definition
(GenBank) transcription regulator
Organism
hhi  Haloarcula hispanica ATCC 33960
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_C_6 TetR_N TetR_C_24 TetR_C_37 TetR_C_27 HAD_2 Sigma70_r4 TetR_C_17 TetR_C_29
Motif
Other DBs
NCBI-ProteinID: AEM59379
UniProt: G0I0F8
Position
pHH400:complement(273457..274047)
Genome map
AA seq 196 aa AA seqDB search
MAGPSDRTFSDQTEEIMQATYRALREHGYADLTIKRIADEYGKSTAAVHYYYDTKDDLLA
AFLDYLLERFVDSIHDVETTDPEARLEILLDELLVKPQENPDLSVALLEMRSQAPYKEAF
SDRFRQNDEYIRYMLKAVINHGIDEGVFSDVDADHVTRSLLTIIDGARTRAVMLDDTEEL
ETARQTASEYADAMLR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggctggaccatcggaccgcaccttctcggaccagaccgaggagataatgcaggcgacc
taccgggcgctgcgcgagcacgggtacgccgatctcacgataaaacggatcgcggacgag
tacggcaaatcgacggctgcagtgcattactactacgacacgaaagacgaccttcttgcg
gcctttctcgattatctgctggagcggttcgtcgattcgattcacgacgtcgagacgacg
gaccccgaagccagactggaaatcttgctcgatgaactgctcgtcaaaccccaggaaaac
cccgatctctcggtcgccctgttagagatgcggagtcaagcaccgtacaaggaggcgttc
agcgaccggttccgacagaacgacgagtacattcggtacatgctcaaggcggtcatcaat
cacgggatcgacgagggtgtgttcagcgacgtcgacgcggatcacgttacccgttcgctg
ctgacgatcatcgacggtgcccggacccgcgccgtgatgctggatgacaccgaggaactc
gaaacagcccgacagacggcgagtgagtacgccgacgcgatgttacggtaa

DBGET integrated database retrieval system